专利摘要:
Proinflammatory cytokines as a diagnostic marker in the episodic vestibular syndrome. Use of proinflammatory cytokines il1 β, il6, tnf α to obtain useful data for the diagnosis and classification of a disease that presents with episodic vestibular syndrome, method of obtaining useful data for the diagnosis and classification of said disease, kit or device and uses. (Machine-translation by Google Translate, not legally binding)
公开号:ES2648694A1
申请号:ES201630745
申请日:2016-06-03
公开日:2018-01-05
发明作者:José Antonio LÓPEZ ESCÁMEZ;Lidia FREJO NAVARRO;Juan Manuel ESPINOSA SÁNCHEZ;María Teresa REQUENA NAVARRO
申请人:Servicio Andaluz de Salud;
IPC主号:
专利说明:

Proinflammatory cytokines as a diagnostic marker in episodic vestibular syndrome.
The present invention is within the field of biomedicine and biotechnology, and refers to the use of proinflammatory cytokines as a diagnostic marker in episodic vestibular syndrome, and especially refers to a method for the classification of patients presenting with episodic vestibular syndrome with migraine and / or hearing loss, and specifically the differential diagnosis of vestibular migraine and Meniere's disease.
STATE OF THE PREVIOUS TECHNIQUE
The classification of episodic vestibular syndrome (EVS) is based on clinical symptoms and there are no biological markers for diagnosis. Currently, consensus diagnoses have been developed for the most frequent causes of spontaneous vertigo that are: vestibular migraine (MV) and Meniere's disease (MS). However, the diagnostic criteria of these entities are not exclusive and the same patient can meet diagnostic criteria for both diseases. In addition, there are patients with an incomplete phenotype that do not meet the clinical criteria and that could be partial forms of the disease. MS is a chronic disorder that affects the inner ear, characterized by recurrent episodes of vertigo, progressive instability, hearing pressure, tinnitus and hearing loss at low and medium frequencies. There are several epidemiological evidences that indicate that MS could have a genetic basis, as well as the role of the immune response and allergy. In this sense, patients with MS have a high prevalence of autoimmune diseases as well as allergic symptoms. However, there is no biological marker to identify which patients with MS have an impaired immune response. Thus, nonspecific autoantibodies such as antinuclear antibodies or circulating immunocomplexes are only elevated in a very low percentage of patients and have no practical diagnostic profitability.
Autoimmune inner ear disease (EAOI) is a chronic disorder of the inner ear that is caused by an immune attack on the inner ear, mediated by antibodies or immunologically active cells. It is characterized by bilateral sensorineural hearing loss, rapidly progressive and often fluctuating, which occurs over a period of weeks to years. Vestibular symptoms, such as instability


Generalized, ataxia, positional vertigo and episodic vertigo, may be present in almost 50% of patients. Occasionally, only one ear is initially affected, but bilateral hearing loss occurs in most patients, with symmetric or asymmetric audiometric thresholds. Almost 25% to 50% of patients also have tinnitus and a sensation of otic fullness, which can be fluctuating.
A wide variety of treatments, both medical and surgical, have been proposed for hearing loss, and specifically for MS. All of them with different results regarding the remission of symptoms and side effects.
Among the medical treatments are the hyposodic diet, antihistamines, diuretics, subcutaneous histamine, antivertiginous drugs, benzodiazepines and transtympanic therapy, especially in that group of patients who do not respond to the usual therapies. However, these treatments have very limited efficacy, due to the clinical heterogeneity of patients with MS.
In some centers, intratympanic injection of ototoxic drugs, such as gentamicin, into the middle ear cavity has been practiced for some time. The objective of this procedure would be to produce a medical labytectomy, which would cause the decrease or disappearance of symptoms. The risk of this procedure is the deterioration of the patient's hearing capacity, especially described in those patients undergoing treatment regimens in short time periods. The most commonly used agents have been, initially, streptomycin and, currently, gentamicin.
In very severe cases, surgery has been resorted to, but this resource worsens the patient's quality of life because it eliminates not only the symptoms, but also the sense of balance.
Therefore, the treatments currently available for hearing loss can be excessively aggressive, such as ablative surgery (vestibular neurectomy or labyrinthyctomy) or the application of intratympanic gentamicin, and can put the patient's hearing at risk. The identification of an autoimmune variant through a high proinflammatory cytokine profile would allow immunosuppressive treatment in this subgroup of patients. In addition, a correct differential diagnosis between MV and MS would allow the administration of appropriate therapies, avoiding the aggressive treatments described above in misdiagnosed patients.


BRIEF DESCRIPTION OF THE INVENTION
Examples of the invention show that IL1β, IL6 and TNFα are useful markers fordifferentiate a disease with episodic vestibular syndrome (attacks of5 vertigo) with migrainous symptoms (headache and / or sensory aura) and / or sensorineural hearing loss,preferably MS and MV, and even more preferably, autoimmune MS.
Therefore, a first aspect of the invention relates to the use of the proinflammatory cytokines IL1β, IL6, TNFα or any combination thereof to obtain 10 data useful for the diagnosis and classification of a disease that develops with episodic vestibular syndrome. In a preferred embodiment, the proinflammatory cytokines IL1β, IL6 and TNFα are used simultaneously. In another preferred embodiment, the determination of proinflammatory cytokines is performed in vitro in human mononuclear cells. In another even more preferred embodiment, the classification of the disease with syndrome
15 vestibular allows obtaining useful data for differential diagnosis between MS and MV, and more specifically, for the diagnosis of autoimmune MS.
MS may present with migrainous symptoms, including headache and MV may have sensorineural hearing loss, being indistinguishable in the early stages of the disease.
A second aspect of the invention relates to a method of obtaining useful data for the diagnosis and classification of a disease that develops with episodic vestibular syndrome, hereafter referred to as the first method of the invention, comprising:
A) detect the levels of IL1β, IL6 and TNFα proinflammatory cytokines in an isolated biological sample from an individual. b) compare the levels of proinflammatory cytokines detected in step (a), with baseline levels in a healthy individual.
In a preferred embodiment of this aspect the invention, the sample isolated in step (a) is peripheral blood, and even more preferably they are mononuclear cells obtained from peripheral blood.
In another even more preferred embodiment, the classification of the disease with vestibular syndrome allows obtaining useful data for the differential diagnosis between MS and MV, and more specifically, for the diagnosis of autoimmune MS.


A third aspect of the invention relates to a method for the diagnosis and classification of a disease that develops with episodic vestibular syndrome, hereafter referred to as the second method of the invention, comprising steps (a) and (b) of the first method. of the invention, and also comprises:
c) include the individual in the group of individuals with MS of autoimmune origin.
In a preferred embodiment of this aspect the invention, the sample isolated in step (a) is peripheral blood, and even more preferably they are mononuclear cells obtained from peripheral blood.
Steps (a), (b), and of the methods described above can be totally or partially automated, for example, by means of a robotic sensor device for the quantification of step (a) or the computerized calculation of any of the indices of steps (b), (c) and / or (d), or the computerized classification in the steps
A fourth aspect of the invention relates to a kit or device for the diagnosis and classification of a disease that develops with episodic vestibular syndrome, hereafter referred to as the kit or device of the invention, which comprises the elements necessary to detect the levels of Proinflammatory cytokines IL1β, IL6 and TNFα in an isolated biological sample of an individual. In a preferred embodiment of this aspect the invention, the isolated sample is peripheral blood, and even more preferably they are mononuclear cells obtained from peripheral blood. In another preferred embodiment of this aspect, the kit or device of the invention comprises primers, probes and / or antibodies capable of detecting and quantifying the proinflammatory cytokines IL1β, IL6 and TNFα in an isolated biological sample. Even more preferably, the detection of proinflammatory cytokine levels is performed by immunological techniques, with antibodies, and even more preferably by ELISA. In another preferred embodiment of this aspect of the invention, the antibodies are modified. In another preferred embodiment of this aspect of the invention, the antibody is human, humanized or synthetic. In another preferred embodiment, the antibody is monoclonal and / or is labeled with a fluorochrome. Preferably, the fluorochrome is selected from the list comprising Fluorescein (FITC), Tetramethylrodamine and derivatives, Phycoerythrin (PE), PerCP, Cy5, Texas, allophycocyanin, or any combination thereof.
In another preferred embodiment of this aspect of the invention, the kit or device of the invention is a kit of parts, comprising a component A, formed by a device


for the collection of the sample from step a), and a component B, formed by the elements necessary to carry out the quantitative analysis in the sample from step a) or any of the methods of the invention.
A fifth aspect of the invention relates to the use of the kit of the invention, for the diagnosis and classification of a disease that occurs with episodic vestibular syndrome. In a preferred embodiment of this aspect of the invention, the disease that occurs with vestibular syndrome is MS or MV, being used for the differential diagnosis of MS and MV, and more specifically, for the diagnosis of autoimmune MS.
BRIEF DESCRIPTION OF THE FIGURES
Fig. 1. Interleukin 1β levels in patients with Meniere's disease and controls obtained after the in vitro mononuclear cell test Fig. 2. Interleukin 6 levels in patients with Meniere's disease and controls obtained after the in vitro mononuclear cell test Fig. 3. TNFα levels in patients with Meniere's disease and controls obtained after the in vitro mononuclear cell assay. Fig. 4. Analysis of hierarchical clusters that allows patients to be classified into 2 groups according to their cytokine levels.
DETAILED DESCRIPTION OF THE INVENTION
The present invention provides a method of determining the concentration of proinflammatory cytokines for the differential diagnosis of vestibular migraine and Meniere's disease. The clinical picture is characterized by episodic vestibular symptoms associated with migrainous symptoms, including migraine headache, sensory aura, sensorineural hearing loss, tinnitus and vertigo crisis. The authors of the present invention are the first to demonstrate a relationship between proinflammatory cytokine levels in an in vitro assay using peripheral blood mononuclear cells, which allows the vestibular migraine to be differentiated from Meniere's disease.
Therefore, a first aspect of the invention relates to the use of the proinflammatory cytokines IL1β, IL6, TNFα or any combination thereof to obtain useful data for the diagnosis and classification of a disease that develops with episodic vestibular syndrome. In a preferred embodiment, the proinflammatory cytokines IL1β, IL6 and


TNFα are used simultaneously. In another preferred embodiment, the determination of proinflammatory cytokines is performed in vitro in human mononuclear cells. In another even more preferred embodiment, the classification of the disease with vestibular syndrome allows obtaining useful data for the differential diagnosis between MS and
5 MV, and more specifically, for the diagnosis of autoimmune MS.
MS may present with migrainous symptoms, including headache and MV may have sensorineural hearing loss, being indistinguishable in the early stages of the disease.
A second aspect of the invention relates to a method of obtaining useful data for the diagnosis and classification of a disease that develops with episodic vestibular syndrome, hereafter referred to as the first method of the invention, comprising:
a) detect the levels of the proinflammatory cytokines IL1β, IL6, TNFα, or any combination thereof, in an isolated biological sample of an individual. b) compare the levels of proinflammatory cytokines detected in step (a), with baseline levels in a healthy individual.
In another preferred embodiment the sample isolated in step (a) is peripheral blood, and even more preferably they are mononuclear cells obtained from peripheral blood.
In another even more preferred embodiment, the classification of the disease with vestibular syndrome allows obtaining useful data for the differential diagnosis between MS and MV, and more specifically, for the diagnosis of autoimmune MS.
That is, step (b) consists of detecting the concentrations of IL1β, IL6 or TNFα cytokines or any of their combinations. Preferably, all cytokines of the diagnostic panel of the invention are detected. Simultaneously it means that all are detected to carry out the method of the invention, although they can be detected in any order, without
30 time limit.
An "isolated biological sample" includes, but is not limited to, cells, tissues and / or biological fluids of an organism, obtained by any method known to a person skilled in the art. Preferably, the biological sample isolated from step (a) is a sample of
35 peripheral blood.


The isolated biological sample is peripheral blood, and / or comprises peripheral blood cells (PBCs), more preferably mononuclear cells. These cells are isolated, for example but not limited to, by density gradient separation using Ficoll, which is a density gradient medium based on the principle of differential migration of the blood cells through the media during the centrifugation stage of the process. Once isolated, these cells are incubated under controlled conditions, which make subsequent determinations reliable.
Basal concentrations of the cytokines IL1β, IL6 and TNFα are obtained after maintaining the mononuclear cells for 16 hours in RPMI1640 medium supplemented at conditions of 37 ° C and 7% CO2.
IL-1β - Interleukin-1β is a member of the cytokine family 1. This is produced through macrophages activated as pro-protein, which by proteolytic processes is processed to its active form thanks to caspase 1 (CASP1). This protein is a very important mediator in the inflammatory response, and is involved in a wide variety of cellular activities, including cell proliferation, differentiation and apoptosis. The increase in the production of this cytokine is observed in different diseases such as autoimmune disease of the inner ear, Muckle Wells syndrome or systemic inflammatory disease of neonatal onset.
IL-6 - Interleukin-6 is a glycoprotein secreted by macrophages, T cells and endothelial cells to stimulate the immune response. It also helps in the maturation of B cells and is an antagonist of regulatory T cells. It is a protein with both inflammatory and anti-inflammatory capacity. This cytokine is first produced at sites of acute or chronic inflammation, where it is secreted to the plasma and induces an inflammatory response. It is an important mediator of fever and acute response. IL-6 stimulates inflammatory and autoimmune processes in various diseases, such as diabetes, lupus or rheumatoid arthritis.
TNFα - Tumor necrosis factor alpha is a proinflammatory cytokine that belongs to the tumor necrosis factor superfamily. It is mostly secreted by macrophages and is involved in a broad spectrum of biological processes that include lipid metabolism, coagulation, proliferation, differentiation and cell apoptosis. This cytokine is involved in a wide variety of diseases such as cancer, insulin resistance and


autoimmune diseases (rheumatoid arthritis, ankylosing spondylitis, Crohn's disease, psoriasis).
In the context of the present invention, IL-1β, IL-6 and TNFα are also defined, but not limited to, by a nucleotide or polynucleotide sequence, which constitutes the coding sequence of the sequences collected respectively in the SEQ IDs collected in the Table 3, and which would comprise various variants from: a) nucleic acid molecules encoding said cytokines comprising the nucleotide sequence of SEQ ID listed in Table 1, b) nucleic acid molecules whose hybrid complementary chain with the sequence polynucleotide of a), c) nucleic acid molecules whose sequence differs from a) and / or b) due to the degeneracy of the genetic code, d) nucleic acid molecules encoding said cytokines comprising the nucleotide sequence with an identity of at least 80%, 90%, 95%, 98% or 99% with the SEQ IDs listed in Table 1, respectively, and in which the cytokines encoded by said acid The nuclei possesses the activity and structural characteristics of the cytokines IL-1β, IL-6 and TNFα. Among these nucleic acid molecules are those collected in the SEQ IDs indicated in table 1.
Sequences of the invention: SEQ ID NO: 1
GTGTCTGAAGCAGCCATGGCAGAAGTACCTGAGCTCGCCAGTGAAATGATGGCTTATTA CAGTGGCAATGAGGATGACTTGTTCTTTGAAGCTGATGGCCCTAAACAGATGAAGTGCT CCTTCCAGGACCTGGACCTCTGCCCTCTGGATGGCGGCATCCAGCTACGAATCTCCGA CCACCACTACAGCAAGGGCTTCAGGCAGGCCGCGTCAGTTGTTGTGGCCATGGACAAG CTGAGGAAGATGCTGGTTCCCTGCCCACAGACCTTCCAGGAGAATGACCTGAGCACCT TCTTTCCCTTCATCTTTGAAGAAGGTAGTTAGCCAAGAGCAGGCAGTAGATCTCCACTTG TGTCCTCTTGGAAGTCATCAAGCCCCAGCCAACTCAATTCCCCCAGAGCCAAAGCCCTT TAAAGGTAGAAGGCCCAGCGGGGAGACAAAACAAAGAAGGCTGGAAACCAAAGCAATC ATCTCTTTAGTGGAAACTATTCTTAAAGAAGATCTTGATGGCTACTGACATTTGCAACTC CCTCACTCTTTCTCAGGGGCCTTTCACTTACATTGTCACCAGAGAACCTATCTTCTTCGA CACATGGGATAACGAGGCTTATGTGCACGATGCACCTGTACGATCACTGAACTGCACGC TCCGGGACTCACAGCAAAAAAGCTTGGTGATGTCTGGTCCATATGAACTGAAAGCTCTC CACCTCCAGGGACAGGATATGGAGCAACAAGTGGTGTTCTCCATGTCCTTTGTACAAGG


AGAAGAAAGTAATGACAAAATACCTGTGGCCTTGGGCCTCAAGGAAAAGAATCTGTACC TGTCCTGCGTGTTGAAAGATGATAAGCCCACTCTACAGCTGGAGAGTGTAGATCCCAAA AATTACCCAAAGAAGAAGATGGAAAAGCGATTTGTCTTCAACAAGATAGAAATCAATAAC AAGCTGGAATTTGAGTCTGCCCAGTTCCCCAACTGGTACATCAGCACCTCTCAAGCAGA AAACATGCCCGTCTTCCTGGGAGGGACCAAAGGCGGCCAGGATATAACTGACTTCACC ATGCAATTTGTGTCTTCCTAAAGAGAGCTGTACCCAGAGAGTCCTGTGCTGAATGTGGA CTCAATCCCTAGGGCTGGCAGAAAGGGAACAGAAAGGTTTTTGAGTACGGCTATAGCCT GGACTTTCCTGTTGTCTACACCAATGCCCAACTGCCTGCCTTAGGGTAGTGCTAAGAGG ATCTCCTGTCCATCAGCCAGGACAGTCAGCTCTCTCCTTTCAGGGCCAATCCCCAGCCC TTTTGTTGAGCCAGGCCTCTCTCACCTCTCCTACTCACTTAAAGCCCGCCTGACAGAAA CCACGGCCACATTTGGTTCTAAGAAACCCTCTGTCATTCGCTCCCACATTCTGATGAGC AACCGCTTCCCTATTTATTTATTTATTTGTTTGTTTGTTTTATTCATTGGTCTAATTTATTCA AAGGGGGCAAGAAGTAGCAGTGTCTGTAAAAGAGCCTAGTTTTTAATAGCTATGGAATC AATTCAATTTGGACTGGTGTGCTCTCTTTAAATCAAGTCCTTTAATTAAGACTGAAAATAT ATAAGCTCAGATTATTTAAATGGGAATATTTATAAATGAGCAAATATCATACTGTTCAATG GTTCTGAAATAAACTTCACTGAAGAAAAAAAAA
SEQ ID NO: 2 MATDICNSLTLSQGPFTYIVTREPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPY ELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESV DPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFT MQFVSS
SEQ ID NO: 3 ACCAAACCTCTTCGAGGCACAAGGCACAACAGGCTGCTCTGGGATTCTCTTCAGCCAAT CTTCATTGCTCAAGTGTCTGAAGCAGCCATGGCAGAAGTACCTGAGCTCGCCAGTGAAA TGATGGCTTATTACAGTGGCAATGAGGATGACTTGTTCTTTGAAGCTGATGGCCCTAAA CAGATGAAGTGCTCCTTCCAGGACCTGGACCTCTGCCCTCTGGATGGCGGCATCCAGC TACGAATCTCCGACCACCACTACAGCAAGGGCTTCAGGCAGGCCGCGTCAGTTGTTGT GGCCATGGACAAGCTGAGGAAGATGCTGGTTCCCTGCCCACAGACCTTCCAGGAGAAT GACCTGAGCACCTTCTTTCCCTTCATCTTTGAAGAAGAACCTATCTTCTTCGACACATGG GATAACGAGGCTTATGTGCACGATGCACCTGTACGATCACTGAACTGCACGCTCCGGG ACTCACAGCAAAAAAGCTTGGTGATGTCTGGTCCATATGAACTGAAAGCTCTCCACCTC CAGGGACAGGATATGGAGCAACAAGTGGTGTTCTCCATGTCCTTTGTACAAGGAGAAGA AAGTAATGACAAAATACCTGTGGCCTTGGGCCTCAAGGAAAAGAATCTGTACCTGTCCT GCGTGTTGAAAGATGATAAGCCCACTCTACAGCTGGAGAGTGTAGATCCCAAAAATTAC


CCAAAGAAGAAGATGGAAAAGCGATTTGTCTTCAACAAGATAGAAATCAATAACAAGCT GGAATTTGAGTCTGCCCAGTTCCCCAACTGGTACATCAGCACCTCTCAAGCAGAAAACA TGCCCGTCTTCCTGGGAGGGACCAAAGGCGGCCAGGATATAACTGACTTCACCATGCA ATTTGTGTCTTCCTAAAGAGAGCTGTACCCAGAGAGTCCTGTGCTGAATGTGGACTCAA TCCCTAGGGCTGGCAGAAAGGGAACAGAAAGGTTTTTGAGTACGGCTATAGCCTGGAC TTTCCTGTTGTCTACACCAATGCCCAACTGCCTGCCTTAGGGTAGTGCTAAGAGGATCT CCTGTCCATCAGCCAGGACAGTCAGCTCTCTCCTTTCAGGGCCAATCCCCAGCCCTTTT GTTGAGCCAGGCCTCTCTCACCTCTCCTACTCACTTAAAGCCCGCCTGACAGAAACCAC GGCCACATTTGGTTCTAAGAAACCCTCTGTCATTCGCTCCCACATTCTGATGAGCAACC GCTTCCCTATTTATTTATTTATTTGTTTGTTTGTTTTATTCATTGGTCTAATTTATTCAAAG GGGGCAAGAAGTAGCAGTGTCTGTAAAAGAGCCTAGTTTTTAATAGCTATGGAATCAATT CAATTTGGACTGGTGTGCTCTCTTTAAATCAAGTCCTTTAATTAAGACTGAAAATATATAA GCTCAGATTATTTAAATGGGAATATTTATAAATGAGCAAATATCATACTGTTCAATGGTTC TGAAATAAACTTCACTGAAG
SEQ ID NO: 4 MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKG FRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSL NCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKN LYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAE NMPVFLGGTKGGQDITDFTMQFVSS
SEQ ID NO: 5 GTATTGTGTCACTCAGTTCAAGTACTTGAAATTTATTGAATTGTATTTTCTAAAAAATAGAT AGTTGAGTAAAAGCAAGCTCACATTACATAGACGGATCACAGTGCACGGCTGCGGAGCT GGGAGCAGTGGCTTCGTTTCATGCAGGAAAGAGAACTTGGTTCAGGAGTGTCTACGTT GCTTAAGACAGGAGAGCACTAAAAATGAAACCATCCAGCCATCCTCCCCCATTTTCATTT TCACACCAAAGAATCCCACCGCGGCAGAGGACCACCGTCTCTGTTTAGACAATCGGTG AAGAATGGATGACCTCACTTTCCCCAACAGGCGGGTCCTGAAATGTTATGCACGAAACA AAACTTGAGTAAATGCCCAACAGAGGTCACTGTTTTATCGATCTTGAAGAGATCTCTTCT TAGCAAAGCAAAGAAACCGATTGTGAAGGTAACACCATGTTTGGTAAATAAGTGTTTTGG TGTTGTGCAAGGGTCTGGTTTCAGCCTGAAGCCATCTCAGAGCTGTCTGGGTCTCTGGA GACTGGAGGGACAACCTAGTCTAGAGCCCATTTGCATGAGACCAAGGATCCTCCTGCA AGAGACACCATCCTGAGGGAAGAGGGCTTCTGAACCAGCTTGACCCAATAAGAAATTCT TGGGTGCCGACGCGGAAGCAGATTCAGAGCCTAGAGCCGTGCCTGCGTCCGTAGTTTC CTTCTAGCTTCTTTTGATTTCAAATCAAGACTTACAGGGAGAGGGAGCGATAAACACAAA


CTCTGCAAGATGCCACAAGGTCCTCCTTTGACATCCCCAACAAAGAGGACTGGAGATGT CTGAGGCTCATTCTGCCCTCGAGCCCACCGGGAACGAAAGAGAAGCTCTATCTCCCCT CCAGGAGCCCAGCTATGAACTCCTTCTCCACAAGCGCCTTCGGTCCAGTTGCCTTCTCC CTGGGGCTGCTCCTGGTGTTGCCTGCTGCCTTCCCTGCCCCAGTACCCCCAGGAGAAG ATTCCAAAGATGTAGCCGCCCCACACAGACAGCCACTCACCTCTTCAGAACGAATTGAC AAACAAATTCGGTACATCCTCGACGGCATCTCAGCCCTGAGAAAGGAGACATGTAACAA GAGTAACATGTGTGAAAGCAGCAAAGAGGCACTGGCAGAAAACAACCTGAACCTTCCAA AGATGGCTGAAAAAGATGGATGCTTCCAATCTGGATTCAATGAGGAGACTTGCCTGGTG AAAATCATCACTGGTCTTTTGGAGTTTGAGGTATACCTAGAGTACCTCCAGAACAGATTT GAGAGTAGTGAGGAACAAGCCAGAGCTGTGCAGATGAGTACAAAAGTCCTGATCCAGT TCCTGCAGAAAAAGGCAAAGAATCTAGATGCAATAACCACCCCTGACCCAACCACAAAT GCCAGCCTGCTGACGAAGCTGCAGGCACAGAACCAGTGGCTGCAGGACATGACAACTC ATCTCATTCTGCGCAGCTTTAAGGAGTTCCTGCAGTCCAGCCTGAGGGCTCTTCGGCAA ATGTAGCATGGGCACCTCAGATTGTTGTTGTTAATGGGCATTCCTTCTTCTGGTCAGAAA CCTGTCCACTGGGCACAGAACTTATGTTGTTCTCTATGGAGAACTAAAAGTATGAGCGTT AGGACACTATTTTAATTATTTTTAATTTATTAATATTTAAATATGTGAAGCTGAGTTAATTT ATGTAAGTCATATTTATATTTTTAAGAAGTACCACTTG AAACATTTTATGTATTAGTTTTGA AATAATAATGGAAAGTGGCTATGCAGTTTGAATATCCTTTGTTTCAGAGCCAGATCATTT CTTGGAAAGTGTAGGCTTACCTCAAATAAATGGCTAACTTATACATATTTTTAAAGAAATATATATATAATTATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATAATTATATATAATTATTATATATAATTATATATAATTATATATATA
SEQ ID NO: 6 MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDG ISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYL EYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQD MTTHLILRSFKEFLQSSLRALRQM
SEQ ID NO: 7 CCCGCTCTGGCCCCACCCTCACCCTCCAACAAAGATTTATCAAATGTGGGATTTTCCCA TGAGTCTCAATATTAGAGTCTCAACCCCCAATAAATATAGGACTGGAGATGTCTGAGGCT CATTCTGCCCTCGAGCCCACCGGGAACGAAAGAGAAGCTCTATCTCCCCTCCAGGAGC CCAGCTATGAACTCCTTCTCCACAAGTAAGTGCAGGAAATCCTTAGCCCTGGAACTGCC AGCGGCGGTCGAGCCCTGTGTGAGGGAGGGGTGTGTGGCCCAGGGAGGGCTGGCGG GCGGCCAGCAGCAGAGGCAGGCTCCCAGCTGTGCTGTCAGCTCACCCCTGCGCTCGC TCCCCTCCGGCACAGGCGCCTTCGGTCCAGTTGCCTTCTCCCTGGGGCTGCTCCTGGT


GTTGCCTGCTGCCTTCCCTGCCCCAGTACCCCCAGGAGAAGATTCCAAAGATGTAGCC GCCCCACACAGACAGCCACTCACCTCTTCAGAACGAATTGACAAACAAATTCGGTACAT CCTCGACGGCATCTCAGCCCTGAGAAAGGAGACATGTAACAAGAGTAACATGTGTGAAA GCAGCAAAGAGGCACTGGCAGAAAACAACCTGAACCTTCCAAAGATGGCTGAAAAAGA TGGATGCTTCCAATCTGGATTCAATGAGGAGACTTGCCTGGTGAAAATCATCACTGGTC TTTTGGAGTTTGAGGTATACCTAGAGTACCTCCAGAACAGATTTGAGAGTAGTGAGGAA CAAGCCAGAGCTGTGCAGATGAGTACAAAAGTCCTGATCCAGTTCCTGCAGAAAAAGGT GGGTGTGTCCTCATTCCCTCAACTTGGTGTGGGGGAAGACAGGCTCAAAGACAGTGTC CTGGACAACTCAGGGATGCAATGCCACTTCCAAAAGAGAAGGCTACACGTAAACAAAAG AGTCTGAGAAATAGTTTCTGATTGTTATTGTTAAATCTTTTTTTGTTTGTTTGGTTGGTTG GCTCTCTTCTGCAAAGGACATCAATAACTGTATTTTAAACTATATATTAACTGAGGTGGAT TTTAACATCAATTTTTAATAGTGCAAGAGATTTAAAACCAAAGGCGGGGGGGCGGGCAG AAAAAAGTGCATCCAACTCCAGCCAGTGATCCACAGAAACAAAGACCAAGGAGCACAAA ATGATTTTAAGATTTTAGTCATTGCCAAGTGACATTCTTCTCACTGTGGTTGTTTCAATTC TTTTTCCTACCTTTTACCAGAGAGTTAGTTCAGAGAAATGGTCAGAGACTCAAGGGTGGA AAGAGGTACCAAAGGCTTTGGCCACCAGTAGCTGGCTATTCAGACAGCAGGGAGTAGA CTTGCTGGCTAGCATGTGGAGGAGCCAAAGCTCAATA AGAAGGGGCCTAGAATGAAAC CCTTGGTGCTGATCCTGCCTCTGCCATTTCTACTTAAGCCAGGGTTTCTCATATGTTAAC ATGCATGGGAATTCCCTGGGCATCTTCTTGTGGTGTGGAGTCTGACTTAGCAAGCCTCG GGTGGGTTTGAGGGTCAAATTTCTACCAGGCTTATATCCCTGGTGATGCTGCAGAATTC CAGGACCACACTTGGAGGTTTAAGGCCTTCCACAAGTTACTTATCCCATATGGTGGGTC TATGGAAAGGTGTTTCCCAGTCCTCTTTACACCACCGGATCAGTGGTCTTTCAACAGATC CTAAAGGGATGGTGAGAGGGAAACTGGAGAAAAGTATCAGATTTAGAGGCCACTGAAG AACCCATATTAAAATGCCTTTAAGTATGGGCTCTTCATTCATATACTAAATATGAACTATG TGCCAGGCATTATTTCATATGACAGAATACAAACAAATAAGATAGTGATGCTGGTCAGGC TTGGTGGCTCATGCCTGTATTCCCTAAACTTTGGGAGCCTAAGGTGAGAACTCCTTGAA CTCCTAAGGCCAGGAGTTCAAGACCAGCCTGGATAACATAGCAAGACCCCATCTCTACA AAAAACCAAAACCAAACAAACAAAAATGATAGTGGTGCTTCCCTCAGGATGCTTGTGGT CTAATGGGAGACAGAACAGCAAAGGGATGATTAGAAGTTGGTTGCTGTGAGCCAGGCA CAGTGCTGATATAATCCCAGCGCTATGGGAGGCTGAGGTGGGTGGATCATTTGAGGCC AGGAGTTTAAGACCAGCCTGGTCAACATGGTAAAACCCCATCTCTACTTAAAAATACAAA AAAGTTAGCCAGGCATGGTGGCATACACCTGTAACCCAGCTACTCAGGAGGCTGAGGC ACATGAATCACTTGAACCCAGGAGGCAGAGGTTGCTGTGCACCACTGCACTCCAGCCT GGGTGACAGAACGAGAC CTTGACTCAAAAAAAAAAAAAAGAAGTTTGTTGCTATGGAAG GGTCCTACTCAGAGCAGGCACCCCAGTTAATCTCATTCACCCCACATTTCACATTTGAAC


ATCATCCCATAGCCCAGAGCATCCCTCCACTGCAAAGGATTTATTCAACATTTAAACAAT CCTTTTTACTTTCATTTTC
SEQ ID NO: 8 MNSFSTSKCRKSLALELPAAVEPCVREGCVAQGGLAGGQQQRQAPSCAVSSPLRSLPSGT GAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRK ETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQN RFESSEEQARAVQMSTKVLIQFLQKKVGVSSFPQLGVGEDRLKDSVLDNSGMQCHFQKRR LHVNKRV
SEQ ID NO: 9 AATATTAGAGTCTCAACCCCCAATAAATATAGGACTGGAGATGTCTGAGGCTCATTCTGC CCTCGAGCCCACCGGGAACGAAAGAGAAGCTCTATCTCCCCTCCAGGAGCCCAGCTAT GAACTCCTTCTCCACAAGCGCCTTCGGTCCAGTTGCCTTCTCCCTGGGGCTGCTCCTG GTGTTGCCTGCTGCCTTCCCTGCCCCAGTACCCCCAGGAGAAGATTCCAAAGATGTAG CCGCCCCACACAGACAGCCACTCACCTCTTCAGAACGAATTGACAAACAAATTCGGTAC ATCCTCGACGGCATCTCAGCCCTGAGAAAGGAGACATGTAACAAGAGTAACATGTGTGA AAGCAGCAAAGAGGCACTGGCAGAAAACAACCTGAACCTTCCAAAGATGGCTGAAAAA GATGGATGCTTCCAATCTGGATTCAATGAGGAGACTTGCCTGGTGAAAATCATCACTGG TCTTTTGGAGTTTGAGGTATACCTAGAGTACCTCCAGAACAGATTTGAGAGTAGTGAGG AACAAGCCAGAGCTGTGCAGATGAGTACAAAAGTCCTGATCCAGTTCCTGCAGAAAAAG GCAAAGAATCTAGATGCAATAACCACCCCTGACCCAACCACAAATGCCAGCCTGCTGAC GAAGCTGCAGGCACAGAACCAGTGGCTGCAGGACATGACAACTCATCTCATTCTGCGC AGCTTTAAGGAGTTCCTGCAGTCCAGCCTGAGGGCTCTTCGGCAAATGTAGCATGGGC ACCTCAGATTGTTGTTGTTAATGGGCATTCCTTCTTCTGGTCAGAAACCTGTCCACTGGG CACAGAACTTATGTTGTTCTCTATGGAGAACTAAAAGTATGAGCGTTAGGACACTATTTT AATTATTTTTAATTTATTAATATTTAAATATGTGAAGCTGAGTTAATTTATGTAAGTCATATT TATATTTTTAAGAAGTACCACTTGAAA CATTTTATGTATTAGTTTTGAAATAATAATGGAAA GTGGCTATGCAGTTTGAATATCCTTTGTTTCAGAGCCAGATCATTTCTTGGAAAGTGTAG GCTTACCTCAAATAAATGGCTAACTTATACATATTTTTAAAGAAATATTTATATTGTATTTA TATAATGTATAAATGGTTTTTATACCAATAAATGGCATTTTAAAAAATTCAGCAAAAAAAAA AAAAAAAAAA
SEQ ID NO: 10 MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDG ISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYL


EYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQD MTTHLILRSFKEFLQSSLRALRQM
SEQ ID NO: 11 GTCTCAATATTAGAGTCTCAACCCCCAATAAATATAGGACTGGAGATGTCTGAGGCTCAT TCTGCCCTCGAGCCCACCGGGAACGAAAGAGAAGCTCTATCTCCCCTCCAGGAGCCCA GCTATGAACTCCTTCTCCACAAACATGTAACAAGAGTAACATGTGTGAAAGCAGCAAAG AGGCACTGGCAGAAAACAACCTGAACCTTCCAAAGATGGCTGAAAAAGATGGATGCTTC CAATCTGGATTCAATGAGGAGACTTGCCTGGTGAAAATCATCACTGGTCTTTTGGAGTTT GAGGTATACCTAGAGTACCTCCAGAACAGATTTGAGAGTAGTGAGGAACAAGCCAGAG CTGTGCAGATGAGTACAAAAGTCCTGATCCAGTTCCTGCAGAAAAAGGCAAAGAATCTA GATGCAATAACCACCCCTGACCCAACCACAAATGCCAGCCTGCTGACGAAGCTGCAGG CACAGAACCAGTGGCTGCAGGACATGACAACTCATCTCATTCTGCGCAGCTTTAAGGAG TTCCTGCAGTCCAGCCTGAGGGCTCTTCGGCAAATGTAGCATGGGCACCTCAGATTGTT GTTGTTAATGGGCATTCCTTCTTCTGGTCAGAAACCTGTCCACTGGGCACAGAACTTAT GTTGTTCTCTATGGAGAACTAAAAGTATGAGCGTTAGGACACTATTTTAATTATTTTTAAT TTATTAATATTTAAATATGTGAAGCTGAGTTAATTTATGTAAGTCATATTTATATTTTTAAG AAGTACCACTTGAAACATTTTATGTATTAGTTTTGAAATAATAATGGAAAGTGGCTATGCA GTTTGAATATCCTTTGTTTCAGAGCCAGATCATTTCTTGGAAAGTGTAGGCTTACCTCAA ATAAATGGCTAACTTATACATATTTTTAAAGAAATATTTATATTGTATTTATATAATGTATAA ATGGTTTTTATACCAA TAAATGGCATTTTAAAAAATTCAGCAAAAAAAAAA
SEQ ID NO: 12 MCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEE QARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKE FLQQLSL
SEQ ID NO: 13 CAGACGCTCCCTCAGCAAGGACAGCAGAGGACCAGCTAAGAGGGAGAGAAGCAACTA CAGACCCCCCCTGAAAACAACCCTCAGACGCCACATCCCCTGACAAGCTGCCAGGCAG GTTCTCTTCCTCTCACATACTGACCCACGGCTCCACCCTCTCTCCCCTGGAAAGGACAC CATGAGCACTGAAAGCATGATCCGGGACGTGGAGCTGGCCGAGGAGGCGCTCCCCAA GAAGACAGGGGGGCCCCAGGGCTCCAGGCGGTGCTTGTTCCTCAGCCTCTTCTCCTTC CTGATCGTGGCAGGCGCCACCACGCTCTTCTGCCTGCTGCACTTTGGAGTGATCGGCC CCCAGAGGGAAGAGTTCCCCAGGGACCTCTCTCTAATCAGCCCTCTGGCCCAGGCAGT CAGATCATCTTCTCGAACCCCGAGTGACAAGCCTGTAGCCCATGTTGTAGCAAACCCTC


AAGCTGAGGGGCAGCTCCAGTGGCTGAACCGCCGGGCCAATGCCCTCCTGGCCAATG GCGTGGAGCTGAGAGATAACCAGCTGGTGGTGCCATCAGAGGGCCTGTACCTCATCTA CTCCCAGGTCCTCTTCAAGGGCCAAGGCTGCCCCTCCACCCATGTGCTCCTCACCCAC ACCATCAGCCGCATCGCCGTCTCCTACCAGACCAAGGTCAACCTCCTCTCTGCCATCAA
5 GAGCCCCTGCCAGAGGGAGACCCCAGAGGGGGCTGAGGCCAAGCCCTGGTATGAGCC CATCTATCTGGGAGGGGTCTTCCAGCTGGAGAAGGGTGACCGACTCAGCGCTGAGATC AATCGGCCCGACTATCTCGACTTTGCCGAGTCTGGGCAGGTCTACTTTGGGATCATTGC CCTGTGAGGAGGACGAACATCCAACCTTCCCAAACGCCTCCCCTGCCCCAATCCCTTTA TTACCCCCTCCTTCAGACACCCTCAACCTCTTCTGGCTCAAAAAGAGAATTGGGGGCTT
10 AGGGTCGGAACCCAAGCTTAGAACTTTAAGCAACAAGACCACCACTTCGAAACCTGGGA TTCAGGAATGTGTGGCCTGCACAGTGAAGTGCTGGCAACCACTAAGAATTCAAACTGGG GCCTCCAGAACTCACTGGGGCCTACAGCTTTGATCCCTGACATCTGGAATCTGGAGACC AGGGAGCCTTTGGTTCTGGCCAGAATGCTGCAGGACTTGAGAAGACCTCACCTAGAAAT TGACACAAGTGGACCTTAGGCCTTCCTCTCTCCAGATGTTTCCAGACTTCCTTGAGACA
15 CGGAGCCCAGCCCTCCCCATGGAGCCAGCTCCCTCTATTTATGTTTGCACTTGTGATTA TTTATTATTTATTTATTATTTATTTATTTACAGATGAATGTATTTATTTGGGAGACCGGGGT ATCCTGGGGGACCCAATGTAGGAGCTGCCTTGGCTCAGACATGTTTTCCGTGAAAACG GAGCTGAACAATAGGCTGTTCCCATGTAGCCCCCTGGCCTCTGTGCCTTCTTTTGATTA TGTTTTTTAAAATATTTATCTGATTAAGTTGTCTAAACAATGCTGATTTGGTGACCAACTG 20 TCACTCATTGCTGAGCCTCTGCTCCCCAGGGGAGTTGTGTCTGTAATCGCCCTACTATT CAGTGGCGAGAAATAAAGTTTGCTTAGAAAAGAAAAAAAAAAAAA
SEQ ID NO: 14
MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEF
25 PRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQL VVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEA KPGYEPIYLGLDGYGYGYQYGYGYQYGYGYGYGYGDGLWGDGLWGDWG
Table 3. Sequences of the invention
Gene Name DescriptionGen IDNucleotide sequencesAmino acid sequences
IL1B 1 beta interleukin3553SEQ ID NO: 1 or SEQ ID NO: 3SEQ ID NO: 2 or SEQ ID NO: 4
IL6 Interleukin 63569SEQ ID NO:SEQ ID NO: 6,


5, SEQ ID NO: 7, SEQ ID NO: 9 or SEQ ID NO: 11 SEQ ID NO: 8, SEQ ID NO: 10 or SEQ ID NO: 12
TNF alpha Tumor necrosis factor7124SEQ ID NO: 13SEQ ID NO: 14
In another preferred embodiment of this aspect of the invention, the disease that occurs with the course of vestibular syndrome is Meniere's disease (MS) or autoimmune disease of the inner ear.
In this report it is understood as a disease that presents with episodic vestibular syndrome that in which the patient presents recurrent signs and symptoms that indicate an alteration of the vestibular function, such as vertigo, ataxia, imbalance, nystagmus or oscilopsia. These symptoms may be associated with various hearing symptoms or headache.
10 origin.
In this report, Ménière's disease is understood as the syndrome characterized by uni or bilateral sensorineural hearing loss that affects low and medium frequencies (<2000Hz) and associated with episodes of vertigo and auditory symptoms, such as tinnitus, or
15 otical fullness. In this report, autoimmune disease of the inner ear or autoimmune MS is understood as the syndrome characterized by uni or bilateral sensorineural hearing loss greater than 30dB that affects one or more frequencies and that progresses in a period between 3-90 days. The progression of hearing loss should be greater than 15dB for a frequency or 10dB for 2 frequencies and
20 demonstrated by audiometry. Autoimmune disease of the inner ear is associated with vestibular symptoms in 50% of cases. The onset of sudden hearing loss (<3 days) with an autoimmune risk profile should make autoimmune disease of the inner ear suspect.
As shown in the examples of the present invention, proinflammatory cytokine levels are elevated in a subset of patients with MS (Table 1).


Table 1. Proinflammatory cytokine levels used for the diagnosis of autoimmune Meniere's disease.
Table 2. Cytokine levels in the in vitro assay with mononuclear cells of patients with vestibular migraine and controls
10 Thus, a third aspect of the invention relates to a method for the diagnosis and classification of a disease that develops with episodic vestibular syndrome, hereafter referred to as the second method of the invention, which comprises steps (a) and (b ) of the first method of the invention, and further comprises:
15 c) include the individual in the group of individuals with MS of autoimmune origin.
In a preferred embodiment of this aspect the invention, the sample isolated in step (a) is peripheral blood, and even more preferably they are mononuclear cells obtained from peripheral blood.
The term "individual" or "subject", as used in the description, refers to an animal, preferably a mammal, and more preferably a human being. The term "individual" in this report is synonymous with "patient", and is not intended to be limiting in


no aspect, being able to be this of any age, sex and physical condition. The individual can be anyone, an individual predisposed to a disease (for example, lung cancer) or an individual suffering from said disease. . The cytokine determination of the invention can be done by any method known in the state of the art, for example, but not limited to, by techniques based on the antigen-antibody interaction such as immunoassays (radioimmunoassay, enzyme immunoassay, fluoroimmunoassay, immunochemiluminescent assay), western blot, immunoprecipitation, immunohistochemistry or immunofluorescence, or by means of quantification techniques of genetic material (RNA) such as PCR, real-time PCR, or expression assays.
The term "diagnosis", as used in the present invention, at the greater or lesser risk of suffering from Meniere's disease or at the greater or lesser risk of suffering from the autoimmune disease of the inner ear.
In turn, according to the method of the present invention, other subclassifications could be established within this principal, thus facilitating the choice and establishment of appropriate therapeutic regimens. This discrimination, as understood by one skilled in the art, is not intended to be correct in 100% of the samples analyzed. However, it requires that a statistically significant amount of the analyzed samples be classified correctly. The amount that is statistically significant can be established by a person skilled in the art by using different statistical tools, for example, but not limited, by determining confidence intervals, determining the significance value P, Student test or discriminant functions. Fisher, non-parametric measurements of Mann Whitney, Spearman correlation, logistic regression, linear regression, area under the ROC curve (AUC). Preferably, the confidence intervals are at least 90%, at least 95%, at least 97%, at least 98% or at least 99%. Preferably, the value of p is less than 0.1, 0.05, 0.01, 0.005 or 0.0001. Preferably, the present invention makes it possible to correctly detect the predisposition to the disease or disease differentially by at least 60%, more preferably at least 70%, much more preferably at least 80%, or even much more preferably in at least 90% of the subjects of a certain group or population analyzed.
Steps (a), (b), and of the methods described above may be wholly or partially


automated, for example, by means of a robotic sensor device for the quantification of step (a) or computerized calculation of any of the indices of steps (b), (c) and / or (d), or computerized classification in the steps
5 MEDICAL USES
A fourth aspect of the invention relates to the use of an immunosuppressant for the treatment of an individual from the group of individuals with MS of autoimmune origin identified according to the second method of the invention. In a preferred embodiment of this
The immunosuppressants aspect is selected from the list consisting of: cytostatic agents, glucocorticoids, calcineurin enzyme inhibitors, mTOR inhibitors, antibodies, or any combination thereof.
Even more preferably, cytostatic agents are selected from Azathioprine,
15 nucleoside synthesis inhibitors such as, but not limited to, mycophenolate mofetil and mycophenolic acid, cyclophosphamide, methotrexate, or any combination thereof.
In another preferred embodiment, the glucocorticoids are selected from prednisone, fludrocortisone, triamcinolone, betamethasone, or any combination thereof.
In another preferred embodiment, the calcineurin enzyme inhibitors are selected from cyclosporine, tacrolimus, or their combination.
In another preferred embodiment, mTOR inhibitors are selected from Sirolimus, Everolimus, or their combination.
In another preferred embodiment the antibodies are selected from: anti-CD20, Rituximab; anti-IL-2R, Daclizumab, anti-TNF, Remicade, anti-SR-TNF, Enbrel, Anti-chemokines, or
30 any of their combinations.
The different treatments of the diseases that occur with episodic vestibular syndrome are described below.
35 Preventive treatment of vestibular migraine attacks
1. Anticonvulsants (Valproate, topiramate)


2.  Antidepressants (amitriptyline, nortriptyline, venlafaxine)
3.  Beta-blockers (propranolol, metoprolol, atenolol)
Four.  Calcium antagonists (flunarizine)
5.  Carbonic anhydrase inhibitor: acetazolamideThe treatment is personalized based on other associated pathologies.
Preventive treatment of Meniere's disease crises
one.  Salt-free diet and water overload (> 2000ml water / day)
2.  Betahistine
3.  Diuretics
Four.  Intratimpanic gentamicin
5.  Intratimpanic corticosteroids
6.  Surgery (vestibular neurectomy, labytectomy according to auditory function)
Treatment of autoimmune Meniere's disease and / or autoimmune inner ear disease
one.  Glucocorticoids (prednisone, methyl prednisolone)These are all potential treatments, which could be applied in CD:
2. Immunosuppressants such as cytostatics (cyclophosphamide), folic acid analogs(methotrexate), purine analogs (azathioprine), immunophilin regulatory drugs(cyclosporine, tacrolimus)
3.  Monoclonal antibodies against interleukins or their receptors such as
3.1. AntiTNFalfa: infliximab, etanercept, adalimumab.
3.2. Anti-IL-1beta receptor: Anakinra (this drug is already patented for the treatment ofautoimmune disease of the inner ear, but not for the autoimmune Meniere).
3.3. Anti IL-6: Tolizizumab, siltuximab, sarilumab, olokizumab.
3.4. Anti TWEAK / FN14: BIIB023 (BIOGEN)
KIT OR DEVICE OF THE INVENTION
A fifth aspect of the invention relates to a kit or device for the diagnosis and classification of a disease that occurs with episodic vestibular syndrome, hereafter referred to as the kit or device of the invention, comprising the elements necessary to detect the levels of Proinflammatory cytokines IL1β, IL6 and TNFα in an isolated biological sample of an individual. In a preferred embodiment of this aspect the invention, the isolated sample is peripheral blood, and even more preferably they are cells


mononuclear obtained from peripheral blood. In another preferred embodiment of this aspect, the kit or device of the invention comprises primers, probes and / or antibodies capable of detecting and quantifying the proinflammatory cytokines IL1β, IL6 and TNFα in an isolated biological sample. Even more preferably, the detection of proinflammatory cytokine levels is performed by immunological techniques, with antibodies, and even more preferably by ELISA. In another preferred embodiment of this aspect of the invention, the antibodies are modified. In another preferred embodiment of this aspect of the invention, the antibody is human, humanized or synthetic. In another preferred embodiment, the antibody is monoclonal and / or is labeled with a fluorochrome. Preferably, the fluorochrome is selected from the list comprising Fluorescein (FITC), Tetramethylrodamine and derivatives, Phycoerythrin (PE), PerCP, Cy5, Texas, allophycocyanin, or any combination thereof.
Therefore, preferably, the antibodies of the kit of the invention are conjugated to molecules that emit detectable signals such as a radioactive isotope, an enzyme, a fluorescent particle or a chemiluminescent substance or assays that are measured by light scattering or direct visualization such as they are precipitation, agglutination or radial diffusion.
Said kit or device may contain all those reagents necessary to determine the cytokines of the invention by means of any of the methods existing in the state of the art and / or described herein. The kit can also include, without any limitation, buffers, agents to prevent contamination, inhibitors of protein degradation, etc. On the other hand, the kit can include all the supports and containers necessary for commissioning and optimization. Preferably, the kit further comprises instructions for carrying out any of the methods of the invention.
It is also possible that the antibody (s) are immobilized in spots on a (preferably solid) surface. In one of its embodiments, the kit comprises a microarray, or microarray of the invention. An antibody microarray is a matrix on a solid substrate (usually a glass holder or a thin silicon film cell). Detection is performed colorimetrically by the interaction of a chromogenic substrate and an enzyme that has been coupled to a detector antibody. Each stain contains the antibody (s). Although the number of spots is not limited in any way, there is a preferred embodiment in which the matrix is customized for


methods of the invention. In one embodiment, said custom matrix comprises fifty spots or less, such as thirty spots or less, including twenty spots
or less. Therefore, another aspect of the invention relates to a matrix comprising the antibody (s) of the invention.
Synthesis in situ on a solid support (for example, glass) could be done using ink-jet technology, which requires longer probes. The supports could be, but not limited to, filters or membranes of NC or nylon (charged), silicon, or glass slides for microscopes covered with aminosilanes, polylysine, aldehydes or epoxy.
In another preferred embodiment of this aspect of the invention, the kit or device of the invention is a kit of parts, comprising a component A, formed by a device for collecting the sample from step a), and a component B, formed by the elements necessary to carry out the quantitative analysis in the sample from step a) or any of the methods of the invention.
A sixth aspect of the invention relates to the use of the kit of the invention, for the diagnosis and classification of a disease that occurs with episodic vestibular syndrome. In a preferred embodiment of this aspect of the invention, the disease that occurs with vestibular syndrome is MS or MV, being used for the differential diagnosis of MS and MV, and more specifically, for the diagnosis of autoimmune MS.
The invention also extends to computer programs adapted so that any processing means can implement the methods of the invention. Such programs may have the form of source code, object code, an intermediate source of code and object code, for example, as in partially compiled form, or in any other form suitable for use in the implementation of the processes according to the invention . Computer programs also cover cloud applications based on that procedure.
Therefore, a seventh aspect of the invention relates to a computer program comprising program instructions to make a computer carry out the method according to any of the methods of the invention.


In particular, the invention encompasses computer programs arranged on or within a carrier. The carrier can be any entity or device capable of supporting the program. When the program is incorporated into a signal that can be directly transported by a cable or other device or medium, the carrier may be constituted by said cable or other device or means. As a variant, the carrier could be an integrated circuit in which the program is included, the integrated circuit being adapted to execute, or to be used in the execution of, the corresponding processes.
For example, the programs could be incorporated into a storage medium, such as a ROM, a CD ROM or a semiconductor ROM, a USB memory, or a magnetic recording medium, for example, a floppy disk or a disk Lasted. Alternatively, the programs could be supported on a transmissible carrier signal. For example, it could be an electrical or optical signal that could be transported through an electrical or optical cable, by radio or by any other means.
An eighth aspect of the invention relates to a computer-readable storage medium comprising program instructions capable of having a computer perform the steps of any of the methods of the invention.
A ninth aspect of the invention relates to a transmissible signal comprising program instructions capable of having a computer perform the steps of any of the methods of the invention.
The terms "polynucleotide" and "nucleic acid" are used interchangeably herein, referring to polymeric forms of nucleotides of any length, both ribonucleotides (RNA or RNA) and deoxyribonucleotides (DNA or DNA).
The terms "amino acid sequence", "peptide", "oligopeptide", "polypeptide" and "protein" are used interchangeably herein, and refer to a polymeric form of amino acids of any length, which may be coding or non-coding, Chemically or biochemically modified.
Throughout the description and the claims the word "comprises" and its variants are not intended to exclude other technical characteristics, additives, components or steps. For those skilled in the art, other objects, advantages and characteristics of the invention are


they will come partly from the description and partly from the practice of the invention. The following examples and drawings are provided by way of illustration, and are not intended to be limiting of the present invention.
5 EXAMPLES OF THE INVENTION
The invention will now be illustrated by tests carried out by the inventors.
10 Materials and Methods
Subjects and samples
The present study included a total of 64 patients with Meniere's disease and 29
15 patients with vestibular migraine. Patients were included in 6 centers: Granada University Hospital, Poniente de El Ejido Hospital, Almería, San Agustín de Linares Hospital, Getafe University Hospital, Santiago de Compostela Clinical Hospital, Salamanca University Hospital, Lugo Hospital, between November from 2014 and March 2016. Peripheral blood samples were obtained for cell separation
20 mononuclear and cytokine determination after in vitro testing. These samples were obtained in patients who had not had vertigo crisis at present, nor had they presented it at least 30 days before the date of obtaining the sample. Patients were diagnosed using the diagnostic scale of the American Academy of Otolaryngology-Head and Neck Surgery (AAO-HNS) (Committee on Hearing and
25 Equilibrium guidelines for the diagnosis and evaluation of therapy in Meniere’s disease. American Academy of Otolaryngology – Head and Neck Foundation, Inc. Otolaryngol Head Neck Surg. 1995. 113, 181-185).
A total of 54 samples of Spanish volunteers from the cities of Almería, Granada,
30 Salamanca, Jaén, Lugo and Santiago de Compostela were included as healthy controls. Quality controls were used on the samples of the individuals to exclude those that did not exceed the quality filters (elimination of duplicate samples, extreme values).
A basic neurotological exam including pure tone audiometry, nystagmus in
35 primary position, gaze evoked nystagmus, cephalic agitation nystagmus and standard caloric test was performed in all patients. The auditory stage for each patient


With definitive MS, it is defined as the average of the four-tone average of 0.5, 1, 2 and 3 kHz according to the AAO-HNS criteria: stage 1, ≤ 25 dB; stage 2, 26-40dB, stage 3, 41-70dB, and stage 4,> 70 dB. The diagnosis of migraine was made using the criteria of the International Headache Society and the diagnosis of vestibular migraine through
5 criteria of the Barany Society (2012).
The study was carried out in accordance with the principles of the Helsinki Declaration for research with human beings. The hospital research committee approved the research protocol. Peripheral blood mononuclear cells were isolated by
10 gradient of Ficoll. All patients and healthy individuals gave their informed consent for the study.
In vitro test of mononuclear cells and measurement of cytokines in supernatant using Multiplex plates.
15 Peripheral blood mononuclear cells were isolated by Ficoll density gradients and cultured in RPMI1640 medium supplemented with 10% fetal bovine serum, pyruvate and essential amino acids, plated at 1x106 cells / ml in 12-well plates and incubated 16h at 37 ° C at 7% CO2. At the end of the incubation the cells are
20 centrifuged, the supernatant was stored and the RNA was extracted from the cells.
Multiplex analysis
The levels of the cytokines IL-1β, IL-6, and TNFα were quantified simultaneously by
25 an immunoassay with magnetic beads (EMD Millipore, Billerica, MA, USA) using a Luminex 2000 reader (Luminex Corp., Austin, TX, USA) and analyzed with Luminex x PONENT 3.1 software (Luminex Corp., Austin, TX, USES).
ELISAS
The levels of IL-1β and Il-6 were determined in supernatant by a sandwich ELISA (R&D Systems, Minneapolis, MN, USA) as described in the manufacturer's protocol. All samples were made in duplicate to ensure reproducibility. .
35 The results obtained by Multiplex and ELISA were compared for validation.


Statistic analysis.
A descriptive statistical analysis was done using the SPSS v.22 program (SPSS Inc, Chicago, IL, USA). The variables were compared using the T-student test. 5 A cluster analysis was carried out using the “gplots” package with the Heatmap.2 function of the R studio program.
Results
10 Two subgroups of patients were observed according to baseline levels of proinflammatory cytokines. Forty-two patients (68%) had low cytokine levels (IL-1β = 1.55 ± 1.53; IL-6 = 4.62 ± 4.99 and TNFα = 7.53 ± 6.17) while 20 patients (32%) exhibited elevated baseline levels of cytokines (IL-1β = 28.86 ± 12.84; IL-6 = 153.26 ± 115.26 and TNFα = 47.22 ± 16.01).
15 Individuals with vestibular migraine ((IL-1β = 1.4 ± 2.2; IL-6 = 4.8 ± 5.6 and TNFα = 5.9 ± 3.9) had cytokine levels very similar to that of healthy controls ((IL-1β = 2.3 ± 1.92 ; IL-6 = 4.8 ± 6.1 and TNFα = 5.32 ± 6.35).
The diagnostic profitability of IL-1β was assessed to discriminate between MV and MS, obtaining
20 a sensitivity of 35%, a specificity of 89%, a positive predictive value of 88% and a negative predictive value of 65%.

权利要求:
Claims (8)
[1]
1. A method of obtaining useful data for the diagnosis and classification of a
disease that occurs with episodic vestibular syndrome, which includes:
a) detect the levels of IL1β, IL6 and TNFα proinflammatory cytokines in
an isolated biological sample from an individual, and
b) compare the levels of proinflammatory cytokines detected in the
step (a), with baseline levels in a healthy individual.
[2]
2. A method for the diagnosis and classification of a disease that develops with episodic vestibular syndrome comprises steps (a) and (b) according to the preceding claim, and further comprises:
c) include the individual in the group of individuals with MS of autoimmune origin.
[3]
3. The method according to any of claims 1-2, wherein the sample isolated in step (a) is peripheral blood.
The method according to any of claims 1-3, wherein the sample isolated in step (a) are mononuclear cells obtained from peripheral blood.
[5]
5. The method according to any of claims 1-4, wherein the cytokine determination of the invention is performed by techniques based on the antigen-antibody interaction.
[6]
6. The method according to any of claims 1-5, wherein the cytokine determination of the invention is performed by immunoassay, western blotting, immunoprecipitation, immunohistochemistry or immunofluorescence.
The use of an immunosuppressant in the preparation of a medicament for the treatment of an individual from the group of individuals with MS of autoimmune origin identified by the diagnostic method according to any of claims 1-6.
[8]
8. A kit or device for the diagnosis and classification of a disease that is
with episodic vestibular syndrome comprises antibodies capable of detecting and

quantify the proinflammatory cytokines IL1β, IL6 and TNFα in an isolated biological sample, preferably peripheral blood, and even more preferably, peripheral blood mononuclear cells.
[9]
9. The use of a kit or device according to the previous reinvindication, for diagnosis and
classification of a disease with episodic vestibular syndrome.
[10]
10. The use of a kit or device according to reinvindication 9, where the disease that occurs with episodic vestibular syndrome is MS.
The use of a kit or device according to any of claims 9-10, wherein the disease that occurs with episodic vestibular syndrome is autoimmune MS.

Figure 1

Figure 2

Figure 3

Figure 4

/ LVWDGRGH6HFXHQFLDV
<110> ANDALUS HEALTH SERVICE
<120> Proinflammatory cytokines as a diagnostic marker in theepisodic vestibular syndrome.
<130> FIBAO-16004
<160> 14
<170> PatentIn version 3.5
<210> 1
<211> 1692
<212> DNA
<213> Homo sapiens
<400> 1gtgtctgaag cagccatggc agaagtacct gagctcgcca gtgaaatgat ggcttattac 60agtggcaatg aggatgactt gttctttgaa gctgatggcc ctaaacagat gaagtgctcc 120ttccaggacc tggacctctg ccctctggat ggcggcatcc agctacgaat ctccgaccac 180cactacagca agggcttcag gcaggccgcg tcagttgttg tggccatgga caagctgagg 240aagatgctgg ttccctgccc acagaccttc caggagaatg acctgagcac cttctttccc 300ttcatctttg aagaaggtag ttagccaaga gcaggcagta gatctccact tgtgtcctct 360tggaagtcat caagccccag ccaactcaat tcccccagag ccaaagccct ttaaaggtag 420aaggcccagc ggggagacaa aacaaagaag gctggaaacc aaagcaatca tctctttagt 480ggaaactatt cttaaagaag atcttgatgg ctactgacat ttgcaactcc ctcactcttt 540ctcaggggcc tttcacttac attgtcacca gagaacctat cttcttcgac acatgggata 600acgaggctta tgtgcacgat gcacctgtac gatcactgaa ctgcacgctc cgggactcac 660agcaaaaaag cttggtgatg tctggtccat atgaactgaa agctctccac ctccagggac 720aggatatgga gcaacaagtg gtgttctcca tgtcctttgt acaaggagaa gaaagtaatg 780acaaaatacc tgtggccttg ggcctcaagg aaaagaatct gtacctgtcc tgcgtgttga 840aagatgataa gcccactcta cagctggaga gtgtagatcc caaaaattac ccaaagaaga 900agatggaaaa gcgatttgtc ttcaacaaga tagaaatcaa taacaagctg gaatttgagt 960ctgcccagtt ccccaactgg tacatcagca cctctcaagc agaaaacatg cccgtcttcc 1020tgggagggac caaaggcggc caggatataa ctgacttcac catgcaattt gtgtcttcct 1080aaagagagct gtacccagag agtcctgtgc tgaatgtgga ctcaatccct agggctggca 1140gaaagggaac agaaaggttt ttgagtacgg ctatagcctg gactttcctg ttgtctacac 1200caatgcccaa ctgcctgcct tagggtagtg ctaagaggat ctcctgtcca tcagccagga 1260cagtcagctc tctcctttca gggccaatcc ccagcccttt tgttgagcca ggcctctctc 1320acctctccta ctcacttaaa gcccgcctga cagaaaccac ggccacattt ggttctaaga 1380aaccctctgt cattcgctcc cacattctga tgagcaaccg cttccctatt tatttattta 1440tttgtttgtt tgttttattc attggtctaa tttattcaaa gggggcaaga agtagcagtg 1500

tctgtaaaag agcctagttt ttaatagcta tggaatcaat tcaatttgga ctggtgtgct 1560
ctctttaaat caagtccttt aattaagact gaaaatatat aagctcagat tatttaaatg 1620
ggaatattta taaatgagca aatatcatac tgttcaatgg ttctgaaata aacttcactg 1680
aagaaaaaaa aa 1692
<210> <211> <212> <213> 2 191 PRT Homo sapiens
<400> 2
Met Wing Thr Asp Ile Cys Asn Ser Leu Thr Leu Ser Gln Gly Pro Phe 1 5 10 15
Thr Tyr Ile Val Thr Arg Glu Pro Ile Phe Phe Asp Thr Trp Asp Asn 20 25 30
Glu Ala Tyr Val His Asp Ala Pro Val Arg Ser Leu Asn Cys Thr Leu 35 40 45
Arg Asp Ser Gln Gln Lys Ser Leu Val Met Ser Gly Pro Tyr Glu Leu 50 55 60
Lys Ala Leu His Leu Gln Gly Gln Asp Met Glu Gln Gln Val Val Phe 65 70 75 80
Be Met Be Phe Val Gln Gly Glu Glu Ser Asn Asp Lys Ile Pro Val 85 90 95
Wing Leu Gly Leu Lys Glu Lys Asn Leu Tyr Leu Ser Cys Val Leu Lys 100 105 110
Asp Asp Lys Pro Thr Leu Gln Leu Glu Ser Val Asp Pro Lys Asn Tyr 115 120 125
Pro Lys Lys Lys Met Glu Lys Arg Phe Val Phe Asn Lys Ile Glu Ile 130 135 140
Asn Asn Lys Leu Glu Phe Glu Ser Ala Gln Phe Pro Asn Trp Tyr Ile 145 150 155 160
Ser Thr Ser Gln Ala Glu Asn Met Pro Val Phe Leu Gly Gly Thr Lys 165 170 175
Gly Gly Gln Asp Ile Thr Asp Phe Thr Met Gln Phe Val Ser Ser 180 185 190
<210> <211> <212> <213> 3 1498 DNA Homo sapiens

<400> 3accaaacctc ttcgaggcac aaggcacaac aggctgctct gggattctct tcagccaatc 60ttcattgctc aagtgtctga agcagccatg gcagaagtac ctgagctcgc cagtgaaatg 120atggcttatt acagtggcaa tgaggatgac ttgttctttg aagctgatgg ccctaaacag 180atgaagtgct ccttccagga cctggacctc tgccctctgg atggcggcat ccagctacga 240atctccgacc accactacag caagggcttc aggcaggccg cgtcagttgt tgtggccatg 300gacaagctga ggaagatgct ggttccctgc ccacagacct tccaggagaa tgacctgagc 360accttctttc ccttcatctt tgaagaagaa cctatcttct tcgacacatg ggataacgag 420gcttatgtgc acgatgcacc tgtacgatca ctgaactgca cgctccggga ctcacagcaa 480aaaagcttgg tgatgtctgg tccatatgaa ctgaaagctc tccacctcca gggacaggat 540atggagcaac aagtggtgtt ctccatgtcc tttgtacaag gagaagaaag taatgacaaa 600atacctgtgg ccttgggcct caaggaaaag aatctgtacc tgtcctgcgt gttgaaagat 660gataagccca ctctacagct ggagagtgta gatcccaaaa attacccaaa gaagaagatg 720gaaaagcgat ttgtcttcaa caagatagaa atcaataaca agctggaatt tgagtctgcc 780cagttcccca actggtacat cagcacctct caagcagaaa acatgcccgt cttcctggga 840gggaccaaag gcggccagga tataactgac ttcaccatgc aatttgtgtc ttcctaaaga 900gagctgtacc cagagagtcc tgtgctgaat gtggactcaa tccctagggc tggcagaaag 960ggaacagaaa ggtttttgag tacggctata gcctggactt tcctgttgtc tacaccaatg 1020cccaactgcc tgccttaggg tagtgctaag aggatctcct gtccatcagc caggacagtc 1080agctctctcc tttcagggcc aatccccagc ccttttgttg agccaggcct ctctcacctc 1140tcctactcac ttaaagcccg cctgacagaa accacggcca catttggttc taagaaaccc 1200tctgtcattc gctcccacat tctgatgagc aaccgcttcc ctatttattt atttatttgt 1260ttgtttgttt tattcattgg tctaatttat tcaaaggggg caagaagtag cagtgtctgt 1320aaaagagcct agtttttaat agctatggaa tcaattcaat ttggactggt gtgctctctt 1380taaatcaagt cctttaatta agactgaaaa tatataagct cagattattt aaatgggaat 1440atttataaat gagcaaatat catactgttc aatggttctg aaataaactt cactgaag 1498
<210> 4
<211> 269
<212> PRT
<213> Homo sapiens
<400> 4
Met Wing Glu Val Pro Glu Leu Wing Ser Glu Met Met Wing Tyr Tyr Ser1 5 10 15
Gly Asn Glu Asp Asp Leu Phe Phe Glu Ala Asp Gly Pro Lys Gln Met20 25 30
Lys Cys Ser Phe Gln Asp Leu Asp Leu Cys Pro Leu Asp Gly Gly Ile35 40 45

Gln Leu Arg Ile Ser Asp His His Tyr Ser Lys Gly Phe Arg Gln Ala 50 55 60
Wing Ser Val Val Val Wing Met Asp Lys Leu Arg Lys Met Leu Val Pro 65 70 75 80
Cys Pro Gln Thr Phe Gln Glu Asn Asp Leu Ser Thr Phe Phe Pro Phe 85 90 95
Ile Phe Glu Glu Glu Pro Ile Phe Phe Asp Thr Trp Asp Asn Glu Ala 100 105 110
Tyr Val His Asp Wing Pro Val Arg Ser Leu Asn Cys Thr Leu Arg Asp 115 120 125
Ser Gln Gln Lys Ser Leu Val Met Ser Gly Pro Tyr Glu Leu Lys Wing 130 135 140
Leu His Leu Gln Gly Gln Asp Met Glu Gln Gln Val Val Phe Ser Met 145 150 155 160
Ser Phe Val Gln Gly Glu Glu Ser Asn Asp Lys Ile Pro Val Ala Leu 165 170 175
Gly Leu Lys Glu Lys Asn Leu Tyr Leu Ser Cys Val Leu Lys Asp Asp 180 185 190
Lys Pro Thr Leu Gln Leu Glu Ser Val Asp Pro Lys Asn Tyr Pro Lys 195 200 205
Lys Lys Met Glu Lys Arg Phe Val Phe Asn Lys Ile Glu Ile Asn Asn 210 215 220
Lys Leu Glu Phe Glu Ser Ala Gln Phe Pro Asn Trp Tyr Ile Ser Thr 225 230 235 240
Ser Gln Ala Glu Asn Met Pro Val Phe Leu Gly Gly Thr Lys Gly Gly 245 250 255
Gln Asp Ile Thr Asp Phe Thr Met Gln Phe Val Ser Ser 260 265
<210> <211> <212> <213> 5 1969 DNA Homo sapiens
<400> 5 gtattgtgtc actcagttca agtacttgaa atttattgaa ttgtattttc taaaaaatag 60
atagttgagt aaaagcaagc tcacattaca tagacggatc acagtgcacg gctgcggagc 120
tgggagcagt ggcttcgttt catgcaggaa agagaacttg gttcaggagt gtctacgttg 180
cttaagacag gagagcacta aaaatgaaac catccagcca tcctccccca ttttcatttt
240cacaccaaag aatcccaccg cggcagagga ccaccgtctc tgtttagaca atcggtgaag
300aatggatgac ctcactttcc ccaacaggcg ggtcctgaaa tgttatgcac gaaacaaaac
360ttgagtaaat gcccaacaga ggtcactgtt ttatcgatct tgaagagatc tcttcttagc
420aaagcaaaga aaccgattgt gaaggtaaca ccatgtttgg taaataagtg ttttggtgtt
480gtgcaagggt ctggtttcag cctgaagcca tctcagagct gtctgggtct ctggagactg
540gagggacaac ctagtctaga gcccatttgc atgagaccaa ggatcctcct gcaagagaca 600ccatcctgag ggaagagggc ttctgaacca gcttgaccca ataagaaatt cttgggtgcc 660gacgcggaag cagattcaga gcctagagcc gtgcctgcgt ccgtagtttc cttctagctt 720cttttgattt caaatcaaga cttacaggga gagggagcga taaacacaaa ctctgcaaga 780tgccacaagg tcctcctttg acatccccaa caaagaggac tggagatgtc tgaggctcat 840tctgccctcg agcccaccgg gaacgaaaga gaagctctat ctcccctcca ggagcccagc 900tatgaactcc ttctccacaa gcgccttcgg tccagttgcc ttctccctgg ggctgctcct 960ggtgttgcct gctgccttcc ctgccccagt acccccagga gaagattcca aagatgtagc 1020cgccccacac agacagccac tcacctcttc agaacgaatt gacaaacaaa ttcggtacat 1080cctcgacggc atctcagccc tgagaaagga gacatgtaac aagagtaaca tgtgtgaaag 1140cagcaaagag gcactggcag aaaacaacct gaaccttcca aagatggctg aaaaagatgg 1200atgcttccaa tctggattca atgaggagac ttgcctggtg aaaatcatca ctggtctttt 1260ggagtttgag gtatacctag agtacctcca gaacagattt gagagtagtg aggaacaagc 1320cagagctgtg cagatgagta caaaagtcct gatccagttc ctgcagaaaa aggcaaagaa 1380tctagatgca ataaccaccc ctgacccaac cacaaatgcc agcctgctga cgaagctgca 1440ggcacagaac cagtggctgc aggacatgac aactcatctc attctgcgca gctttaagga 1500gttcctgcag tccagcctga gggctcttcg gcaaatgtag catgggcacc tcagattgtt 1560gttgttaatg ggcattcctt cttctggtca gaaacctgtc cactgggcac agaacttatg 1620ttgttctcta tggagaacta aaagtatgag cgttaggaca ctattttaat tatttttaat 1680ttattaatat ttaaatatgt gaagctgagt taatttatgt aagtcatatt tatattttta 1740agaagtacca cttgaaacat tttatgtatt agttttgaaa taataatgga aagtggctat 1800gcagtttgaa tatcctttgt ttcagagcca gatcatttct tggaaagtgt aggcttacct 1860caaataaatg gctaacttat acatattttt aaagaaatat ttatattgta tttatataat 1920gtataaatgg tttttatacc aataaatggc attttaaaaa attcagcaa
1969
<210> 6
<211> 212
<212> PRT
<213> Homo sapiens
<400> 6

Met Asn Ser Phe Ser Thr Ser Ala Phe Gly Pro Val Ala Phe Ser Leu1 5 10 15
Gly Leu Leu Leu Val Leu Pro Wing Wing Phe Pro Wing Pro Val Pro Pro 20 25 30
Gly Glu Asp Ser Lys Asp Val Ala Ala Pro His Arg Gln Pro Leu Thr 35 40 45
Be Ser Glu Arg Ile Asp Lys Gln Ile Arg Tyr Ile Leu Asp Gly Ile 50 55 60
Ser Ala Leu Arg Lys Glu Thr Cys Asn Lys Ser Asn Met Cys Glu Ser 65 70 75 80
Ser Lys Glu Ala Leu Ala Glu Asn Asn Leu Asn Leu Pro Lys Met Ala 85 90 95
Glu Lys Asp Gly Cys Phe Gln Ser Gly Phe Asn Glu Glu Thr Cys Leu 100 105 110
Val Lys Ile Ile Thr Gly Leu Leu Glu Phe Glu Val Tyr Leu Glu Tyr 115 120 125
Leu Gln Asn Arg Phe Glu Ser Ser Glu Glu Gln Ala Arg Ala Val Gln 130 135 140
Met Ser Thr Lys Val Leu Ile Gln Phe Leu Gln Lys Lys Ala Lys Asn 145 150 155 160
Leu Asp Wing Ile Thr Thr Pro Asp Pro Thr Thr Asn Wing Ser Leu Leu 165 170 175
Thr Lys Leu Gln Wing Gln Asn Gln Trp Leu Gln Asp Met Thr Thr His 180 185 190
Leu Ile Leu Arg Ser Phe Lys Glu Phe Leu Gln Ser Ser Leu Arg Wing 195 200 205
Leu Arg Gln Met 210
<210> <211> <212> <213> 7 2555 DNA Homo sapiens
<400> 7 cccgctctgg ccccaccctc accctccaac aaagatttat caaatgtggg attttcccat 60
gagtctcaat attagagtct caacccccaa taaatatagg actggagatg tctgaggctc 120
attctgccct cgagcccacc gggaacgaaa gagaagctct atctcccctc caggagccca 180
gctatgaact ccttctccac aagtaagtgc aggaaatcct tagccctgga actgccagcg 240

gcggtcgagc cctgtgtgag ggaggggtgt gtggcccagg gagggctggc gggcggccag
300cagcagaggc aggctcccag ctgtgctgtc agctcacccc tgcgctcgct cccctccggc
360acaggcgcct tcggtccagt tgccttctcc ctggggctgc tcctggtgtt gcctgctgcc
420ttccctgccc cagtaccccc aggagaagat tccaaagatg tagccgcccc acacagacag
480ccactcacct cttcagaacg aattgacaaa caaattcggt acatcctcga cggcatctca
540gccctgagaa aggagacatg taacaagagt aacatgtgtg aaagcagcaa agaggcactg
600gcagaaaaca acctgaacct tccaaagatg gctgaaaaag atggatgctt ccaatctgga 660ttcaatgagg agacttgcct ggtgaaaatc atcactggtc ttttggagtt tgaggtatac 720ctagagtacc tccagaacag atttgagagt agtgaggaac aagccagagc tgtgcagatg 780agtacaaaag tcctgatcca gttcctgcag aaaaaggtgg gtgtgtcctc attccctcaa 840cttggtgtgg gggaagacag gctcaaagac agtgtcctgg acaactcagg gatgcaatgc 900cacttccaaa agagaaggct acacgtaaac aaaagagtct gagaaatagt ttctgattgt 960tattgttaaa tctttttttg tttgtttggt tggttggctc tcttctgcaa aggacatcaa 1020taactgtatt ttaaactata tattaactga ggtggatttt aacatcaatt tttaatagtg 1080caagagattt aaaaccaaag gcgggggggc gggcagaaaa aagtgcatcc aactccagcc 1140agtgatccac agaaacaaag accaaggagc acaaaatgat tttaagattt tagtcattgc 1200caagtgacat tcttctcact gtggttgttt caattctttt tcctaccttt taccagagag 1260ttagttcaga gaaatggtca gagactcaag ggtggaaaga ggtaccaaag gctttggcca 1320ccagtagctg gctattcaga cagcagggag tagacttgct ggctagcatg tggaggagcc 1380aaagctcaat aagaaggggc ctagaatgaa acccttggtg ctgatcctgc ctctgccatt 1440tctacttaag ccagggtttc tcatatgtta acatgcatgg gaattccctg ggcatcttct 1500tgtggtgtgg agtctgactt agcaagcctc gggtgggttt gagggtcaaa tttctaccag 1560gcttatatcc ctggtgatgc tgcagaattc caggaccaca cttggaggtt taaggccttc 1620cacaagttac ttatcccata tggtgggtct atggaaaggt gtttcccagt cctctttaca 1680ccaccggatc agtggtcttt caacagatcc taaagggatg gtgagaggga aactggagaa 1740aagtatcaga tttagaggcc actgaagaac ccatattaaa atgcctttaa gtatgggctc 1800ttcattcata tactaaatat gaactatgtg ccaggcatta tttcatatga cagaatacaa 1860acaaataaga tagtgatgct ggtcaggctt ggtggctcat gcctgtattc cctaaacttt 1920gggagcctaa ggtgagaact ccttgaactc ctaaggccag gagttcaaga ccagcctgga 1980taacatagca agaccccatc tctacaaaaa accaaaacca aacaaacaaa aatgatagtg 2040gtgcttccct caggatgctt gtggtctaat gggagacaga acagcaaagg gatgattaga 2100agttggttgc tgtgagccag gcacagtgct gatataatcc cagcgctatg ggaggctgag 2160gtgggtggat catttgaggc caggagttta agaccagcct ggtcaacatg gtaaaacccc 2220atctctactt aaaaatacaa aaaagttagc caggcatggt ggcatacacc tgtaacccag 2280

ctactcagga ggctgaggca catgaatcac ttgaacccag gaggcagagg ttgctgtgca 2340
ccactgcact ccagcctggg tgacagaacg agaccttgac tcaaaaaaaa aaaaaagaag 2400
tttgttgcta tggaagggtc ctactcagag caggcacccc agttaatctc attcacccca 2460
catttcacat ttgaacatca tcccatagcc cagagcatcc ctccactgca aaggatttat 2520
tcaacattta aacaatcctt tttactttca ttttc 2555
<210> <211> <212> <213> 8 252 PRT Homo sapiens
<400> 8
Met Asn Ser Phe Ser Thr Ser Lys Cys Arg Lys Ser Leu Ala Leu Glu 1 5 10 15
Leu Pro Wing Wing Val Glu Pro Cys Val Arg Glu Gly Cys Val Wing Gln 20 25 30
Gly Gly Leu Wing Gly Gly Gln Gln Gln Arg Gln Wing Pro Ser Cys Wing 35 40 45
Val Ser Ser Pro Leu Arg Ser Leu Pro Ser Gly Thr Gly Ala Phe Gly 50 55 60
Pro Val Wing Phe Ser Leu Gly Leu Leu Leu Val Leu Pro Wing Wing Phe 65 70 75 80
Pro Ala Pro Val Pro Pro Gly Glu Asp Ser Lys Asp Val Ala Ala Pro 85 90 95
His Arg Gln Pro Leu Thr Ser Ser Glu Arg Ile Asp Lys Gln Ile Arg 100 105 110
Tyr Ile Leu Asp Gly Ile Ser Ala Leu Arg Lys Glu Thr Cys Asn Lys 115 120 125
Be Asn Met Cys Glu Be Be Lys Glu Ala Leu Ala Glu Asn Asn Leu 130 135 140
Asn Leu Pro Lys Met Wing Glu Lys Asp Gly Cys Phe Gln Ser Gly Phe 145 150 155 160
Asn Glu Glu Thr Cys Leu Val Lys Ile Ile Thr Gly Leu Leu Glu Phe 165 170 175
Glu Val Tyr Leu Glu Tyr Leu Gln Asn Arg Phe Glu Ser Ser Glu Glu 180 185 190
Gln Wing Arg Wing Val Gln Met Ser Thr Lys Val Leu Ile Gln Phe Leu 195 200 205
Gln Lys Lys Val Gly Val Ser Ser Phe Pro Gln Leu Gly Val Gly Glu210 215 220
Asp Arg Leu Lys Asp Ser Val Leu Asp Asn Ser Gly Met Gln Cys His225 230 235 240
Phe Gln Lys Arg Arg Leu His Val Asn Lys Arg Val245 250
<210> 9
<211> 1201
<212> DNA
<213> Homo sapiens
<400> 9aatattagag tctcaacccc caataaatat aggactggag atgtctgagg ctcattctgc 60cctcgagccc accgggaacg aaagagaagc tctatctccc ctccaggagc ccagctatga 120actccttctc cacaagcgcc ttcggtccag ttgccttctc cctggggctg ctcctggtgt 180tgcctgctgc cttccctgcc ccagtacccc caggagaaga ttccaaagat gtagccgccc 240cacacagaca gccactcacc tcttcagaac gaattgacaa acaaattcgg tacatcctcg 300acggcatctc agccctgaga aaggagacat gtaacaagag taacatgtgt gaaagcagca 360aagaggcact ggcagaaaac aacctgaacc ttccaaagat ggctgaaaaa gatggatgct 420tccaatctgg attcaatgag gagacttgcc tggtgaaaat catcactggt cttttggagt 480ttgaggtata cctagagtac ctccagaaca gatttgagag tagtgaggaa caagccagag 540ctgtgcagat gagtacaaaa gtcctgatcc agttcctgca gaaaaaggca aagaatctag 600atgcaataac cacccctgac ccaaccacaa atgccagcct gctgacgaag ctgcaggcac 660agaaccagtg gctgcaggac atgacaactc atctcattct gcgcagcttt aaggagttcc 720tgcagtccag cctgagggct cttcggcaaa tgtagcatgg gcacctcaga ttgttgttgt 780taatgggcat tccttcttct ggtcagaaac ctgtccactg ggcacagaac ttatgttgtt 840ctctatggag aactaaaagt atgagcgtta ggacactatt ttaattattt ttaatttatt 900aatatttaaa tatgtgaagc tgagttaatt tatgtaagtc atatttatat ttttaagaag 960taccacttga aacattttat gtattagttt tgaaataata atggaaagtg gctatgcagt 1020ttgaatatcc tttgtttcag agccagatca tttcttggaa agtgtaggct tacctcaaat 1080aaatggctaa cttatacata tttttaaaga aatatttata ttgtatttat ataatgtata 1140aatggttttt ataccaataa atggcatttt aaaaaattca gcaaaaaaaa aaaaaaaaaa 1200to 1201
<210> 10
<211> 212
<212> PRT
<213> Homo sapiens
<400> 10

Met Asn Ser Phe Ser Thr Ser Ala Phe Gly Pro Val Ala Phe Ser Leu1 5 10 15
Gly Leu Leu Leu Val Leu Pro Wing Wing Phe Pro Wing Pro Val Pro Pro 20 25 30
Gly Glu Asp Ser Lys Asp Val Ala Ala Pro His Arg Gln Pro Leu Thr 35 40 45
Be Ser Glu Arg Ile Asp Lys Gln Ile Arg Tyr Ile Leu Asp Gly Ile 50 55 60
Ser Ala Leu Arg Lys Glu Thr Cys Asn Lys Ser Asn Met Cys Glu Ser 65 70 75 80
Ser Lys Glu Ala Leu Ala Glu Asn Asn Leu Asn Leu Pro Lys Met Ala 85 90 95
Glu Lys Asp Gly Cys Phe Gln Ser Gly Phe Asn Glu Glu Thr Cys Leu 100 105 110
Val Lys Ile Ile Thr Gly Leu Leu Glu Phe Glu Val Tyr Leu Glu Tyr 115 120 125
Leu Gln Asn Arg Phe Glu Ser Ser Glu Glu Gln Ala Arg Ala Val Gln 130 135 140
Met Ser Thr Lys Val Leu Ile Gln Phe Leu Gln Lys Lys Ala Lys Asn 145 150 155 160
Leu Asp Wing Ile Thr Thr Pro Asp Pro Thr Thr Asn Wing Ser Leu Leu 165 170 175
Thr Lys Leu Gln Wing Gln Asn Gln Trp Leu Gln Asp Met Thr Thr His 180 185 190
Leu Ile Leu Arg Ser Phe Lys Glu Phe Leu Gln Ser Ser Leu Arg Wing 195 200 205
Leu Arg Gln Met 210
<210> <211> <212> <213> 11 1006 DNA Homo sapiens
<400> 11 gtctcaatat tagagtctca acccccaata aatataggac tggagatgtc tgaggctcat 60
tctgccctcg agcccaccgg gaacgaaaga gaagctctat ctcccctcca ggagcccagc 120
tatgaactcc ttctccacaa acatgtaaca agagtaacat gtgtgaaagc agcaaagagg 180
cactggcaga aaacaacctg aaccttccaa agatggctga aaaagatgga tgcttccaat 240

ctggattcaa tgaggagact tgcctggtga aaatcatcac tggtcttttg gagtttgagg 300tatacctaga gtacctccag aacagatttg agagtagtga ggaacaagcc agagctgtgc 360agatgagtac aaaagtcctg atccagttcc tgcagaaaaa ggcaaagaat ctagatgcaa 420taaccacccc tgacccaacc acaaatgcca gcctgctgac gaagctgcag gcacagaacc 480agtggctgca ggacatgaca actcatctca ttctgcgcag ctttaaggag ttcctgcagt 540ccagcctgag ggctcttcgg caaatgtagc atgggcacct cagattgttg ttgttaatgg 600gcattccttc ttctggtcag aaacctgtcc actgggcaca gaacttatgt tgttctctat 660ggagaactaa aagtatgagc gttaggacac tattttaatt atttttaatt tattaatatt 720taaatatgtg aagctgagtt aatttatgta agtcatattt atatttttaa gaagtaccac 780ttgaaacatt ttatgtatta gttttgaaat aataatggaa agtggctatg cagtttgaat 840atcctttgtt tcagagccag atcatttctt ggaaagtgta ggcttacctc aaataaatgg 900ctaacttata catattttta aagaaatatt tatattgtat ttatataatg tataaatggt 960ttttatacca ataaatggca ttttaaaaaa ttcagcaaaa aaaaaa 1006
<210> 12
<211> 136
<212> PRT
<213> Homo sapiens
<400> 12
Met Cys Glu Ser Ser Lys Glu Ala Leu Ala Glu Asn Asn Leu Asn Leu1 5 10 15
Pro Lys Met Wing Glu Lys Asp Gly Cys Phe Gln Ser Gly Phe Asn Glu20 25 30
Glu Thr Cys Leu Val Lys Ile Ile Thr Gly Leu Leu Glu Phe Glu Val35 40 45
Tyr Leu Glu Tyr Leu Gln Asn Arg Phe Glu Ser Ser Glu Glu Gln Ala50 55 60
Arg Wing Val Gln Met Ser Thr Lys Val Leu Ile Gln Phe Leu Gln Lys65 70 75 80
Lys Wing Lys Asn Leu Asp Wing Ile Thr Thr Pro Asp Pro Thr Thr Asn85 90 95
Ser Ser Leu Leu Thr Lys Leu Gln Gln Wing Asn Gln Trp Leu Gln Asp100 105 110
Met Thr Thr His Leu Ile Leu Arg Ser Phe Lys Glu Phe Leu Gln Ser115 120 125
Ser Leu Arg Ala Leu Arg Gln Met130 135

<210> 13
<211> 1686
<212> DNA
<213> Homo sapiens
<400> 13cagacgctcc ctcagcaagg acagcagagg accagctaag agggagagaa gcaactacag
60accccccctg aaaacaaccc tcagacgcca catcccctga caagctgcca ggcaggttct
120cttcctctca catactgacc cacggctcca ccctctctcc cctggaaagg acaccatgag
180cactgaaagc atgatccggg acgtggagct ggccgaggag gcgctcccca agaagacagg 240ggggccccag ggctccaggc ggtgcttgtt cctcagcctc ttctccttcc tgatcgtggc 300aggcgccacc acgctcttct gcctgctgca ctttggagtg atcggccccc agagggaaga 360gttccccagg gacctctctc taatcagccc tctggcccag gcagtcagat catcttctcg 420aaccccgagt gacaagcctg tagcccatgt tgtagcaaac cctcaagctg aggggcagct 480ccagtggctg aaccgccggg ccaatgccct cctggccaat ggcgtggagc tgagagataa 540ccagctggtg gtgccatcag agggcctgta cctcatctac tcccaggtcc tcttcaaggg 600ccaaggctgc ccctccaccc atgtgctcct cacccacacc atcagccgca tcgccgtctc 660ctaccagacc aaggtcaacc tcctctctgc catcaagagc ccctgccaga gggagacccc 720agagggggct gaggccaagc cctggtatga gcccatctat ctgggagggg tcttccagct 780ggagaagggt gaccgactca gcgctgagat caatcggccc gactatctcg actttgccga 840gtctgggcag gtctactttg ggatcattgc cctgtgagga ggacgaacat ccaaccttcc 900caaacgcctc ccctgcccca atccctttat taccccctcc ttcagacacc ctcaacctct 960tctggctcaa aaagagaatt gggggcttag ggtcggaacc caagcttaga actttaagca 1020acaagaccac cacttcgaaa cctgggattc aggaatgtgt ggcctgcaca gtgaagtgct 1080ggcaaccact aagaattcaa actggggcct ccagaactca ctggggccta cagctttgat 1140ccctgacatc tggaatctgg agaccaggga gcctttggtt ctggccagaa tgctgcagga 1200cttgagaaga cctcacctag aaattgacac aagtggacct taggccttcc tctctccaga 1260tgtttccaga cttccttgag acacggagcc cagccctccc catggagcca gctccctcta 1320tttatgtttg cacttgtgat tatttattat ttatttatta tttatttatt tacagatgaa 1380tgtatttatt tgggagaccg gggtatcctg ggggacccaa tgtaggagct gccttggctc 1440agacatgttt tccgtgaaaa cggagctgaa caataggctg ttcccatgta gccccctggc 1500ctctgtgcct tcttttgatt atgtttttta aaatatttat ctgattaagt tgtctaaaca 1560atgctgattt ggtgaccaac tgtcactcat tgctgagcct ctgctcccca ggggagttgt 1620gtctgtaatc gccctactat tcagtggcga gaaataaagt ttgcttagaa aagaaaaaaa 1680aaaaaa 1686
<210> 14
<211> 233

<212> PRT
<213> Homo sapiens
<400> 14
Met Ser Thr Glu Ser Met Ile Arg Asp Val Glu Leu Ala Glu Glu Ala1 5 10 15
Leu Pro Lys Lys Thr Gly Gly Pro Gln Gly Ser Arg Arg Cys Leu Phe20 25 30
Leu Ser Leu Phe Ser Phe Leu Ile Val Ala Gly Ala Thr Thr Leu Phe35 40 45
Cys Leu Leu His Phe Gly Val Ile Gly Pro Gln Arg Glu Glu Phe Pro50 55 60
Arg Asp Leu Ser Leu Ile Ser Pro Leu Gln Wing Val Val Arg Ser Ser65 70 75 80
Ser Arg Thr Pro Ser Asp Lys Pro Val Ala His Val Val Ala Asn Pro85 90 95
Gln Wing Glu Gly Gln Leu Gln Trp Leu Asn Arg Arg Wing Asn Wing Leu100 105 110
Leu Wing Asn Gly Val Glu Leu Arg Asp Asn Gln Leu Val Val Pro Ser115 120 125
Glu Gly Leu Tyr Leu Ile Tyr Ser Gln Val Leu Phe Lys Gly Gln Gly130 135 140
Cys Pro Ser Thr His Val Leu Leu Thr His Thr Ile Ser Arg Ile Ala145 150 155 160
Val Ser Tyr Gln Thr Lys Val Asn Leu Leu Ser Ala Ile Lys Ser Pro165 170 175
Cys Gln Arg Glu Thr Pro Glu Gly Ala Glu Ala Lys Pro Trp Tyr Glu180 185 190
Pro Ile Tyr Leu Gly Gly Val Phe Gln Leu Glu Lys Gly Asp Arg Leu195 200 205
Ser Ala Glu Ile Asn Arg Pro Asp Tyr Leu Asp Phe Ala Glu Ser Gly210 215 220
Gln Val Tyr Phe Gly Ile Ile Ala Leu225 230
类似技术:
公开号 | 公开日 | 专利标题
Zimmerman et al.2005|Cerebrospinal fluid and serum markers of inflammation in autism
Navikas et al.1996|Augmented expression of tumour necrosis factor-α and lymphotoxin in mononuclear cells in multiple sclerosis and optic neuritis
Bonneh-Barkay et al.2010|YKL-40 expression in traumatic brain injury: an initial analysis
CN1543571A|2004-11-03|Process for differential diagnosis of alzheimer&#39;s dementia in patients exhibiting mild cognitive impairment
ES2353722T3|2011-03-04|PROCEDURE FOR IN VITRO DIAGNOSIS BY EXAMINATION OF THE CEPHALORRAQUID LIQUID FOR THE DIAGNOSIS OF DEMENTIAL DISEASES AND NEUROINFLAMATORY DISEASES.
ES2400255T3|2013-04-08|In vitro procedure for the diagnosis and early diagnosis of neurodegenerative diseases
JP2021043216A|2021-03-18|Composition for diagnosis of diseases
Stejskal et al.2011|DETERMINATION OF SERUM VISININ LIKE PROTEIN-1 AND ITS POTENTIAL FOR THE DIAGNOSIS OF BRAIN INJURY DUE TO THE STROKE-A PILOT STUDY.
Tasca et al.2018|Muscle microdialysis to investigate inflammatory biomarkers in facioscapulohumeral muscular dystrophy
ES2534330T3|2015-04-21|Biological analysis method for antibody against thyroid stimulating hormone receptor, measurement kit for antibody, and genetically modified cell modified for use in the biological analysis method or in the measurement kit
Kuzior et al.2020|Increased IL-8 concentrations in the cerebrospinal fluid of patients with unipolar depression
Kester et al.2012|Decreased mRNA expression of CCL5 [RANTES] in Alzheimer's disease blood samples
ES2648694A1|2018-01-05|Proinflammatory cytokines as a diagnostic marker in the episodic vestibular syndrome. |
Hansen et al.2020|CD19+ B-cells in autoantibody-negative limbic encephalitis
Sun et al.2018|Upregulated IRAK1 and IRAK4 promoting the production of IFN-γ and IL-17 in Behcet’s disease
Brockmann2013|Episodic movement disorders: from phenotype to genotype and back
EP3002588B1|2022-01-12|Use of a biomarker for diagnosing schizophrenia
Vijatov-Djuric et al.2017|Interleukin-17A levels increase in serum of children with juvenile idiopathic arthritis
WO2020188136A1|2020-09-24|Panel of cytokines/chemokines for differential diagnosis in episodic vestibular syndrome
JP4925063B2|2012-04-25|Diagnostic marker for migraine and its use
Suhadolnik et al.2004|Clinical and biochemical characteristics differentiating chronic fatigue syndrome from major depression and healthy control populations: relation to dysfunction in the RNase L pathway
Yi et al.2021|Increased serum IL-27 concentrations and IL-27-producing cells in MG patients with positive AChR-Ab
WO2012026885A1|2012-03-01|Early diagnosis of childhood wheeze and eczema with mediators from cord blood mononuclear
KR102064136B1|2020-01-08|A method of detecting wheezing of pediatric respiratory infections using eosinophil-derived neurotoxin
KR101970007B1|2019-04-17|Method of measuring amount of ex vivo interferon-gamma for diagnosing, monitoring, or prognosing in autoimmune disease
同族专利:
公开号 | 公开日
ES2648694B1|2018-10-22|
WO2017207859A1|2017-12-07|
引用文献:
公开号 | 申请日 | 公开日 | 申请人 | 专利标题

WO2020188136A1|2019-03-20|2020-09-24|Servicio Andaluz De Salud|Panel of cytokines/chemokines for differential diagnosis in episodic vestibular syndrome|
法律状态:
2018-10-22| FG2A| Definitive protection|Ref document number: 2648694 Country of ref document: ES Kind code of ref document: B1 Effective date: 20181022 |
优先权:
申请号 | 申请日 | 专利标题
ES201630745A|ES2648694B1|2016-06-03|2016-06-03|Proinflammatory cytokines as a diagnostic marker in episodic vestibular syndrome.|ES201630745A| ES2648694B1|2016-06-03|2016-06-03|Proinflammatory cytokines as a diagnostic marker in episodic vestibular syndrome.|
PCT/ES2017/070400| WO2017207859A1|2016-06-03|2017-06-02|Pro-inflammatory cytokines as diagnostic marker in episodic vestibular syndrome|
[返回顶部]