• 专利附录
  • 专利说明
  • 权利要求
  • 类似技术
  • 同族专利
  • 引用文献
  • 法律状态
  • 优先权
    • 专利摘要:
    Abstract Method for making heteromultimeric molecules The present invention provides methods for making heteromultimeric molecules, such as bispecific antibodies, and compositions comprising said molecules. The method includes introducing mutations in amino acids that are in contact at the interface of two polypeptides, such that the electrostatic interaction between the ion pairs is altered.
    公开号:AU2013203859A1
    申请号:U2013203859
    申请日:2013-04-11
    公开日:2013-05-02
    发明作者:Austin L. Gurney；Aaron Ken Sato
    申请人:Oncomed Pharmaceuticals Inc；
    IPC主号:A61K39-395
    专利说明:
    METHOD FOR MAKING HETEROMULTIMERIC MOLECULES BACKGROUND OF THE INVENTION Field of the Invention [00011 The present invention provides methods for making heteromultimeric molecules, such as bispecific antibodies, and compositions comprising said molecules. The methods include introducing substitutions in amino acids that are in contact at the interface between two polypeptides. Such substitutions include changes in amino acids that result in altered electrostatic and/or hydrophobic/hydrophilic interactions between the polypeptides that make up the heteromultimeric molecules. The substitutions result in multimeric molecules in which homomultimeric molecules are disfavored, and heteromultimeric molecules are preferentially formed. Background Art 10002] The hallmark of monoclonal antibodies is their ability to specifically bind to a particular antigen, which enables them to bind to their target in vivo but not antigen negative sites. Once bound to a target, therapeutic monoclonal antibodies can deliver a toxic payload, act as agonists or antagonists of receptors, or as neutralizers of ligands. Monoclonal antibodies can also be modified to be more immunologically tolerated in various species. One such modification, that entails the replacement of amino acids in structural regions with amino acids found in humans, is humanization. Humanized antibodies can then be further modified. One such modification is arming the humanized antibody with additional cytotoxic mechanisms, be it radioisotopes, bacterial toxins, inflammatory cytokines, chemotherapeutics or prodrugs. [00031 There is a growing number of approved cancer therapeutics that are efficacious either as a chimerized antibody (Rituximab) or humanized IgG1 (Herceptin and Campath 1H), as conjugate with chemotherapeutics (Mylotarg) or a radioisotope (Zevalin and Bexxar). In spite of this progress, the efficacy of monoclonal antibodies for cancer treatment is still limited, leaving great potential for further improvements. One class of -2 antibody derivatives with the promise of enhanced potency for cancer treatment is bispecific antibodies. [00041 Antibodies with a dual specificity in their binding arms usually do not occur in nature and, therefore, were developed through recombinant DNA or cell-fusion technology. Most bispecific antibodies are designed to recruit cytotoxic effector cells of the immune system effectively against pathogenic target cells. After more than 15 years of extensive research, many different types of bispecific antibodies have been developed but only a few have advanced to clinical trials. [00051 Among the first bispecific antibodies were constructs designed to redirect T cells against cancer target cells. Target cells are killed when cytotoxic T lymphocytes (CTLs) are tethered to tumor cells and simultaneously triggered by one arm of the bispecific antibody that interact with the T-cell receptor (TCR)-CD3 complex. CTLs, which are considered to be the most potent killer cells of the immune system, cannot be engaged by monoclonal antibodies because they lack Fcy-receptors. [00061 Another type of bispecific antibody is those that simultaneously bind tumor cells and an activating Fcy-receptor, for example, CD64/FcyRI on monocytes. Binding of this type of bispecific antibody to Fey-receptors can elicit effector cell activation, without being competed by simultaneously binding normal IgG. [00071 One method for generating bispecific antibodies has been termed the "knobs-into holes" strategy (see, e.g., WO 2006/028936). The mispairing of Ig heavy chains is reduced in this technology by mutating selected amino acids forming the interface of the CH3 domains in human IgG. At positions within the CH3 domain at which the two heavy chains interact directly, an amino acid with a small side chain (hole) is introduced into the sequence of one heavy chain and an amino acid with a large side chain (knob) into that of the other one. As a result, the protein interaction between knobs and holes has been described as leading to the formation of up to 90% of the correct bispecific human IgG by transfected mammalian host cells. [00081 The present invention provides methods for preferentially forming heteromultimeric molecules by mutating selected amino acids that interact at the interface between two polypeptides by replacing an amino acid residue involved in hydrophilic interactions with a more hydrophobic amino acid residue and/or replacing an amino acid involved in a charge interaction with another amino acid.
    -3 BRIEF SUMMARY OF THE INVENTION [0009] The present invention provides a method of preparing a heteromultimeric polypeptide comprising two human immunoglobulin CH3 domain-containing polypeptides, the method comprising substituting at least one amino acid within the CH3 domain of one of the polypeptides at a position corresponding to a position selected from the group consisting of positions 236, 245, 249, 278, 286, and 288 of human IgG2 with another amino acid, thereby promoting heteromultimer formation. In one embodiment, the invention provides a method of preparing a heteromultimeric polypeptide comprising two human immunoglobulin CH3 domain-containing polypeptides, the method comprising substituting at least one charged amino acid residue in the CH3 domain of each of the polypeptides with an amino acid of the opposite charge. In another embodiment, the pair of substituted amino acids form an ion pair in the heteromultimeric polypeptide. [00101 In another embodiment, the invention provides a method of preparing a heteromultimeric polypeptide comprising two human immunoglobulin CH3 domain containing polypeptides, the method comprising substituting at least one hydrophilic amino acid residue in the CH3 domain of one of the polypeptides with another amino acid. In one embodiment, the hydrophilic amino acid residue is substituted by a hydrophobic residue. In certain embodiments, the substitution causes replacement of an amino acid having a hydroxyl side chain is substituted with an amino acid that does not have a hydroxyl side chain. In a further embodiment, the method further comprises substituting at least one hydrophilic amino acid residue in the CH3 domain of one of the polypeptides with another amino acid at the interface of the two polypeptides in one of the polypeptides with another amino acid. In yet another embodiment, the substituted amino acid interacts with another amino acid at the interface of the two polypeptides. Representative amino acids that are predicted to interact at the interface include those listed in Table 1, or is an amino acid at a position corresponding to those listed in Table 1. [0011] In one embodiment, the human immunoglobulin CH3 domain of both polypeptides is selected from the group consisting of IgG, IgA, and IgD CH3 domains. In a further embodiment, the immunoglobulin CH3 domain is an IgG2 CH3 domain. [00121 In one embodiment, the first CH3-domain containing polypeptide comprises a first immunoglobulin heavy chain polypeptide that specifically binds to a first -4 immunoglobulin light chain polypeptide, and the second CH3-domain containing polypeptide comprises a second immunoglobulin heavy chain polypeptide that specifically binds to a second immunoglobulin light chain polypeptide. In a further embodiment, the first immunoglobulin light chain polypeptide and the second immunoglobulin light chain polypeptide are identical in amino acid sequence. [0013] In one embodiment, the method comprises substituting amino acids in one CH3 domain at positions corresponding to position 249 and position 288 of human IgG2. In a further embodiment, the amino acids at positions 249 and 288 are replaced with glutamate. In another embodiment, the amino acids at positions 249 and 288 are replaced with aspartate. In one embodiment, the method comprises substituting amino acids in one CH3 domain at positions corresponding to position 249, position 286, and position 288 of human IgG2. In a further embodiment, the amino acids at positions 249 and 288 are replaced with glutamate, and the amino acid at position 286 is replaced with phenylalanine. In one embodiment, the method further comprises substituting amino acids in the second CH3 domain at positions corresponding to position 236 and position 278 of human IgG2. In another embodiment, the amino acid at position 236 is replaced with a lysine, and the amino acid at position 278 is replaced with a lysine. [00141 In one embodiment, the method comprises substituting amino acids in one CH3 domain at positions corresponding to position 236 and position 278 of human IgG2. In another embodiment, the amino acid at position 236 is replaced with a lysine, and the amino acid at position 278 is replaced with a lysine. [00151 In one embodiment, the method comprises preparing a heteromultimeric polypeptide that is monovalent. In another embodiment, the method comprises preparing a monovalent heteromultimeric polypeptide comprising a detectable label or epitope. [00161 In one embodiment, the method comprises preparing a heteromultimeric polypeptide that is bivalent. In another embodiment, the first polypeptide binds a target molecule through its immunoglobulin antigen binding domain, and the second polypeptide is an immunoadhesin. In one embodiment, the first and second polypeptides preferentially assemble with each other as heterodimers, relative to assembly of homodimers. In another embodiment, the first and second polypeptides assemble to form a bispecific antibody.
    -5 [00171 In one embodiment, the method comprises preparing a heteromultimeric molecule wherein the first CH3-domain containing polypeptide comprises a first immunoglobulin heavy chain polypeptide that specifically binds to a first immunoglobulin light chain polypeptide, and the second CH3-domain containing polypeptide comprises a second immunoglobulin heavy chain polypeptide that specifically binds to a second immunoglobulin light chain polypeptide. In another embodiment, the first immunoglobulin light chain polypeptide and the second immunoglobulin light chain polypeptide are identical in amino acid sequence. In another embodiment, the immunoglobulin light chain polypeptide is linked to the immunoglobulin heavy chain polypeptide. [00181 In one embodiment, the method comprises preparing a bispecific antibody that specifically binds two different antigens. In another embodiment, the bispecific antibody binds two different epitopes on the same antigen. [0019] In one embodiment, the method comprises preparing a heteromultimeric polypeptide that specifically binds an antigen selected from the group consisting of: DLL4, VEGF, VEGFR2, Notch1, Notch2, Notch3, Notch4, Notch(pan), JAGI, JAG2, DLL(pan), JAG(pan), EGFR, ERBB2, ERBB3, ERBB(pan), c-Met, IGF-1R, PDGFR, Patched, Hedgehog family polypeptides, Hedgehog(pan), WNT family polypeptides, WNT(pan), FZD1, FZD2, FZD3, FZD4, FZD5, FZD6, FZD7, FZD8, FZD9, FZD1O, FZD(pan), LRP5, LRP6, CD20, IL-6, TNFalpha, IL-23, IL-17, CD80, CD86, CD3, CEA, Mucl6, PSMA, PSCA, CD44, c-Kit, DDR1, DDR2, RSPO1, RSPO2, RSPO3, RSPO4, RSPO(pan), BMP family polypeptides, BMP (pan), BMPRIa, BMPR1b, and a combination thereof. [0020] In one embodiment, the method comprises preparing a heteromultimeric polypeptide comprises the VEGF binding sequence comprising heavy chain sequence of SEQ ID NO:l1 and the light chain sequence of SEQ ID NO:13 or SEQ ID NO:15. In another embodiment, the heteromultimeric polypeptide comprises the VEGF binding sequence comprising heavy chain sequence of SEQ ID NO:11 and the light chain sequence of SEQ ID NO: 13. In another embodiment, the heteromultimeric polypeptide comprises the VEGF binding sequence comprising heavy chain sequence of SEQ ID NO: 11 and the light chain sequence of SEQ ID NO:15. In yet another embodiment, the -6 heteromultimeric polypeptide comprises the DLL4 binding sequence comprising SEQ ID NO:19. [0021] In one embodiment, the method comprises preparing a heteromultimeric polypeptide is a bispecific antibody that binds DLL4 and VEGF. In one embodiment, the heteromultimeric polypeptide comprises light chain polypeptides that are identical in sequence. In another embodiment, the light chain polypeptides are linked to the heavy chain polypeptides. In another embodiment, the bispecific antibody comprises the VEGF binding sequence comprising heavy chain sequence of SEQ ID NO: 11 and the light chain sequence of SEQ ID NO:13 or SEQ ID NO:15; and the DLL4 binding sequence comprising SEQ ID NO:19. In another embodiment, the heteromultimeric polypeptide comprises the VEGF binding sequence comprising heavy chain sequence of SEQ ID NO:1 1 and the light chain sequence of SEQ ID NO:13; and the DLL4 binding sequence comprising SEQ ID NO:19. In a further embodiment, the heteromultimeric polypeptide comprises the VEGF binding sequence comprising heavy chain sequence of SEQ ID NO: 11 and the light chain sequence of SEQ ID NO:15; and the DLL4 binding sequence comprising SEQ ID NO:19. 100221 The invention also provides an antibody that specifically binds VEGF, wherein the antibody comprises: (a) a heavy chain CDR1 comprising GYTFTNYWMH (SEQ ID NO:20), a heavy chain CDR2 comprising SINPSNGGTSYNEKFKR (SEQ ID NO:21), and a heavy chain CDR3 comprising HYYDNSYAMDY (SEQ ID NO:22); and/or (b) a light chain CDR1 comprising QASQDISNYVN (SEQ ID NO:23), a light chain CDR2 comprising DASNLQT (SEQ ID NO:24), and a light chain CDR3 comprising QQYDDLPP (SEQ ID NO:25). The invention also provides an antibody that specifically binds VEGF, wherein the antibody comprises: (a) a heavy chain CDR1 comprising GYTFTNYWMH (SEQ ID NO:20), a heavy chain CDR2 comprising SINPSNGGTSYNEKFKR (SEQ ID NO:21), and a heavy chain CDR3 comprising HYYDNSYAMDY (SEQ ID NO:22); and/or (b) a light chain CDR1 comprising RASQGINNHLAW (SEQ ID NO:26), a light chain CDR2 comprising AASNLHS (SEQ ID NO:27), and a light chain CDR3 comprising QQYDNLPL (SEQ ID NO:28). [00231 In one embodiment, the antibody is an antagonist of human VEGF. In another embodiment, the anti-VEGF antibody is an antibody fragment. In one embodiment, the antibody is a monoclonal antibody or a humanized antibody.
    -7 [00241 In one embodiment, the anti-VEGF antibody inhibits tumor growth. [0025] In one embodiment, the anti-VEGF antibody binds to human VEGF with a KD Of about 100 nM or less. [0026] The invention also provides a heteromultimeric polypeptide prepared by the methods described herein. In one embodiment, the heteromultimeric polypeptide has the characteristics of a heteromultimeric polypeptide prepared by the methods described herein. [00271 In one embodiment, the heteromultimeric polypeptide is monovalent. [00281 In another embodiment, the heteromultimeric polypeptide is bivalent. In a further embodiment, the heteromultimeric polypeptide is a bispecific antibody. [00291 The invention also provides a polypeptide comprising an immunoglobulin CH3 domain, wherein the CH3 domain contains a glutamate at positions corresponding to positions 249 and 288 of human IgG2. [00301 The invention also provides a polypeptide comprising an immunoglobulin CH3 domain, wherein the CH3 domain contains a glutamate at positions corresponding to positions 249 and 288 of human IgG2 and a phenylalanine at a position corresponding to position 286 of human IgG2. [00311 The invention also provides a polypeptide comprising an immunoglobulin CH3 domain, wherein the CH3 domain contains a lysine at positions corresponding to positions 236 and 278 of human IgG2. [00321 In one embodiment, the polypeptide immunoglobulin CH3 domain is an IgG CH3 domain. [0033] In one embodiment, the heteromultimeric polypeptide comprises both (i) a polypeptide comprising an immunoglobulin CH3 domain, wherein the CH3 domain contains a glutamate at positions corresponding to positions 249 and 288 of human IgG2, or a polypeptide comprising an immunoglobulin CH3 domain, wherein the CH3 domain contains a glutamate at positions corresponding to positions 249 and 288 of human IgG2 and a phenylalanine at a position corresponding to position 286 of human IgG2, and (ii) a polypeptide comprising an immunoglobulin CH3 domain, wherein the CH3 domain contains a lysine at positions corresponding to positions 236 and 278 of human IgG2. [00341 In one embodiment, the first and/or second CH3-domain containing polypeptide(s) further comprise an immunoglobulin CH2 domain.
    -8 [0035] In one embodiment, the polypeptide comprises the amino acid sequence of SEQ ID NO:1, SEQ ID NO:4, or SEQ ID NO:5. [0036] In one embodiment, the polypeptide comprises the amino acid sequence of SEQ ID NO:2, SEQ ID NO:6, or SEQ ID NO:7. [0037] In one embodiment, the polypeptide comprises the amino acid sequence of SEQ ID NO:3, SEQ ID NO:8, or SEQ ID NO:9. 100381 In one embodiment, the heteromultimeric polypeptide comprises both a first amino acid sequence selected from the group consisting of SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, and SEQ ID NO:7; and a second amino acid sequence selected from the group consisting of SEQ ID NO:3, SEQ ID NO:8, and SEQ ID NO:9. [00391 The invention further provides a heteromultimeric polypeptide comprising a polypeptide selected from SEQ ID NOs:1-9. In one embodiment, the heteromultimeric polypeptide is a heterodimer. In a further embodiment, the heteromultimeric polypeptide is a bispecific antibody. In another embodiment, the heteromultimeric polypeptide is a monovalent antibody. [00401 In one embodiment, the heteromultimeric polypeptide specifically binds an antigen selected from the group consisting of: DLL4, VEGF, VEGFR2, Notchl, Notch2, Notch3, Notch4, Notch(pan), JAGI, JAG2, DLL(pan), JAG(pan), EGFR, ERBB2, ERBB3, ERBB(pan), c-Met, IGF-1R, PDGFR, Patched, Hedgehog family polypeptides, Hedgehog(pan), WNT family polypeptides, WNT(pan), FZD1, FZD2, FZD3, FZD4, FZD5, FZD6, FZD7, FZD8, FZD9, FZD10, FZD(pan), LRP5, LRP6, CD20, IL-6, TNFalpha, IL-23, IL-17, CD80, CD86, CD3, CEA, Muc16, PSMA, PSCA, CD44, c-Kit, DDR1, DDR2, RSPO1, RSPO2, RSPO3, RSPO4, RSPO(pan), BMP family polypeptides, BMP(pan), BMPRla, BMPR1b, and a combination thereof. [00411 In one embodiment, the heteromultimeric polypeptide comprises the VEGF binding sequence comprising heavy chain sequence of SEQ ID NO: 11 and the light chain sequence of SEQ ID NO:13 or SEQ ID NO:15. In another embodiment, the heteromultimeric polypeptide comprises the VEGF binding sequence comprising heavy chain sequence of SEQ ID NO:11 and the light chain sequence of SEQ ID NO:13. In one embodiment, the heteromultimeric polypeptide comprises the VH sequence of SEQ ID NO:10 and the VL sequence of SEQ ID NOs: 29 or 30. In another embodiment, the -9 heteromultimeric polypeptide comprises the VEGF binding sequence comprising heavy chain sequence of SEQ ID NO:11 and the light chain sequence of SEQ ID NO:15. In yet another embodiment, the heteromultimeric polypeptide comprises the DLL4 binding sequence comprising SEQ ID NO:19. [00421 In one embodiment, the heteromultimeric polypeptide is a bispecific antibody that binds DLL4 and VEGF. In one embodiment, the VEGF binding sequence comprises SEQ ID NO:17 or SEQ ID NO:18. In one embodiment, the DLL4 binding sequence comprises SEQ ID NO: 19. In another embodiment, the bispecific antibody comprises the VEGF binding sequence comprising heavy chain sequence of SEQ ID NO:11 and the light chain sequence of SEQ ID NO:13 or SEQ ID NO:15; and the DLL4 binding sequence comprising SEQ ID NO: 19. In another embodiment, the heteromultimeric polypeptide comprises the VEGF binding sequence comprising heavy chain sequence of SEQ ID NO:11 and the light chain sequence of SEQ ID NO:13; and the DLL4 binding sequence comprising SEQ ID NO:19. In a further embodiment, the heteromultimeric polypeptide comprises the VEGF binding sequence comprising heavy chain sequence of SEQ ID NO:1 1 and the light chain sequence of SEQ ID NO:15; and the DLL4 binding sequence comprising SEQ ID NO:19. [00431 In one embodiment, the heteromultimeric polypeptide comprises light chain polypeptides are identical in amino acid sequence. In another embodiment, heteromultimeric polypeptide comprises light chain polypeptides that are linked to the heavy chain polypeptides. [0044] In one embodiment, the heteromultimeric polypeptide comprises substituting amino acids in one CH3 domain at positions corresponding to position 249 and position 288 of human IgG2. In one embodiment, the heteromultimeric polypeptide the amino acids at positions 249 and 288 are replaced with glutamate. In another embodiment, the amino acids at positions 249 and 288 are replaced with aspartate. [00451 In one embodiment, the heteromultimeric polypeptide comprises substituting amino acids in the second CH3 domain at positions corresponding to position 236 and position 278 of human IgG2. In one embodiment, the heteromultimeric polypeptide the amino acid at position 236 is replaced with a lysine, and the amino acid at position 278 is replaced with a lysine. In one embodiment, the heteromultimeric polypeptide comprises - 10 substituting amino acids in one CH3 domain at positions corresponding to position 236 and position 278 of human IgG2. [00461 In one embodiment, the first and/or second CH3-domain containing polypeptide(s) further comprise a single chain Fv. [00471 The invention also provides an isolated polypeptide comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 10, 29, and 30. In one embodiment, the isolated polypeptide is an antibody. [0048] In one embodiment, the heteromultimeric polypeptide further comprises a cytotoxin or a radioisotope. [00491 The invention also provides a polynucleotide encoding the polypeptides or antibodies of the invention. The invention also provides polynucleotides that hybridize under conditions of high stringency to the polynucleotides encoding the polypeptides or antibodies of the invention. [00501 The invention also provides a host cell comprising a polynucleotide of the invention. [0051] The invention also provides a method of making a heteromultimeric polypeptide comprising culturing the host cell under conditions that result in expression of the polypeptide. [00521 The invention also provides for a pharmaceutical composition comprising the heteromultimeric polypeptide of the invention and a pharmaceutically acceptable carrier. [00531 The invention also provides a method of treating a disorder comprising administering the heteromultimeric polypeptide or a composition of the invention to a patient in need thereof. In one embodiment, the disorder is cancer. In another embodiment, the method further comprises administering a second therapeutic compound. In one embodiment, the second therapeutic compound is used to treat a side effect caused by administration of the heteromultimeric polypeptide in the patient. In another embodiment, the second therapeutic compound is an anti-cancer agent. In yet another embodiment, the heteromultimeric polypeptide and the second therapeutic compound are administered simultaneously or sequentially.
    - 11 BRIEF DESCRIPTIONS OF THE DRAWINGS [00541 Figure 1: The structure of antibody CH2 and CH3 domains. The structure is shown in ribbon view using the Pymol software program (DeLano Scientific LLC, California USA) of the antibody fc domain structure deposited in structure deposited in PDB (file 1FC1) (Deisenhofer.J. (1981) Biochemistry, 20, 2361-2370). The CH2 and CH3 domains of each chain in the dimeric structure are shown. The dimerization of the Fe fragment is mediated through interactions between CH3 domains. [00551 Figure 2: The CH3 dimer interface. Shown is a ribbon structure view of the CH3 domain. On the left is an image of the dimer of two CH3 domains. On the right is an image of a single CH3 domain with depiction of the side chains of amino acids with potential to participate in inter-chain interactions. [00561 Figure 3: Select amino acids are involved in inter-chain interactions. Shown are three separate views of dimerized CH3 domain chosen to best view particular amino acid residues. The structure is shown in ribbon view using the Pymol software program (DeLano Scientific LLC, California USA). Each view highlights selected amino acids that are postulated to contribute to inter-chain pairing. Individual amino acids are highlighted by depiction of the side chains and by notation of amino acid and position. The numbering scheme is relative to human IgG2 constant region. [00571 Figure 4: The alignment of human IgG isotypes. Shown is an alignment of the constant region of human IgG isotypes IgGI, IgG2, IgG3, and IgG4. The CH3 domain is indicated by line. Individual amino acids that were highlighted in Figure 2 and Figure 3 and are postulated to play roles in inter-chain interactions are denoted by filled circles. [00581 Figure 5: An assay format for assessing homodimerization and heterodimerization. In order to determine the relative propensity of an Fe variant to homodimerize or heterodimerize with another Fe variant we generated a "mini-body" expression construct encoding the linker region and CH2-CH3 domains (amino acids 103-326 of the human IgG2 constant region) of IgG2 linked to an N terminal signal sequence and FLAG epitope. This construct, when transfected cells directs the expression of a secreted dimeric Fc domain (here termed "minibody"). As revealed by western blot analysis, the size of the minibody is substantially smaller than the size of an intact antibody produced by transfecting cells with expression vectors encoding heavy and light chains. Heterodimer formation can be assessed by transfecting a cell with -12 vectors encoding both the intact antibody and the mini-body Fc domain construct. Heterodimer formation will result in an intermediate size molecule containing one chain of minibody and one full length heavy chain complexed with light chain. [00591 Figure 6: Antibody variants that efficiently form heterodimeric Fc domains. Expression vector plasmids were generated that encode FLAG tagged minibody with wild type human IgG2 CH2 and CH3 domains (WT), and variants (Varl, also referred to as 13B, and Var2), a full length heavy chains with wild type human IgG2 CH2 and CH3 domains (WT), or a variant (Var3/13A), and a full length light chain (L2). Var contains amino acid 249 Lys to Glu substitution and amino acid 288 Lys to Glu substitution within the CH3 domain. Antibody Var2 contains substitutions of amino acid 249 Lys to Glu substitution, amino acid 286 Tyr to Phe, and amino acid 288 Lys to Glu within the CH3 domain. Antibody Var3 (also referred to as 13A) contains substitutions of amino acid 236 Glu to Lys and amino acid 278 Asp to Lys. HEK293 cells were transiently transfected with combinations of expression vectors as indicated. Non-reducing Western blot analysis was conducted with an anti-FLAG antibody to reveal the size of the secreted antibody products. Wild type human IgG2 readily exhibits homodimerization, as shown in the right panel where expressed Flag tagged "minibody" containing wild type human CH2-CH3 domain is readily detected. Antibody Varl (13B) has greatly reduced ability to homodimenize. Antibody Var2 exhibits little to no ability to homodimerize. In the middle panel and left panel minibody variants are co-expressed with full length heavy chain variants, and heterodimer antibody forms are produced. Co-expression of wild type full length heavy chain and wild type minibody results in production of both homodimer (as clearly demonstrated by the anti-FLAG western blot in the middle panel and by the intermediate mass bands observed in the anti-Fc Western blot in the right panel). These data show that coexpression of Varl (13B) and Var3 (13A) results in preferential homodimerization, and that co-expression of Var2 and Var3 results in almost exclusive formation of heterodimer. [00601 Figure 7: The binding of a bispecific antibody binds to two targets. Enyzme linked immunosorbent assay (ELISA) was conducted to examine the ability of bispecific antibody variant (Var2-Var3) to bind to antigens. ELISA plates were coated with either no antigen (-), anti-FLAG antibody (0.05 mg/ml, clone M2 from SIGMA), or recombinant human DLL4 (0.1 mg/ml) (amino acids 27-519 with a carboxy-terminal - 13 8xHis tag). Coated plates were then incubated with control cell culture medium (negative control) or conditioned medium from cells transfected with expression vectors encoding Var2, Var3, and light chain L2 as indicated. The results show that the bispecific antibody variant produced by co-expression of Var2 and Var3 heavy chains and L2 light chain is able to bind to DLL4, the antibody recognized by the parental wild-type antibody used to generate Var3, and also to bind the anti-FLAG antibody due to the FLAG epitope tag presented by the Var2 heavy chain variant arm. [0061] Figure 8: Anti-VEGF Fab (219R0302) partially blocks VEGF-induced HUVEC proliferation. Day 7 HUVEC cells were screened for inhibition of proliferation against the anti-VEGF Fab fragment 219R0302. M199-+2% FBS was used as the starvation media and the volume was normalized to the lowest concentration of the testing sample. 219R0302 Fab was tested against various test antibodies, bevacizumab (Avastin), and recombinant human VEGF as a control. [00621 Figure 9: Anti-VEGF Fab (219R0302) blocks binding of VEGFR2 Fe to hVEGF biacore surface. A VEGF surface was generated using standard NHS/EDC chemistry on a CM5 chip. 219R0302 Fab or a control non-binding Fab were flowed over the surface and then immediate thereafter VEGFR2 was injected. As shown, VEGFR2 bound well to VEGF in the control Fab experiment and was blocked in the 219R0302 Fab experiment. [00631 Figure 10: Anti-VEGF IgGs (219R0302 and 219R0202) block VEGF-induced HUVEC proliferation to similar extent as bevacizumab (Avastin). 21R0302 and 219R0202 IgGs were reformatted to IgG2, expressed, and purified for confirmatory in vitro testing. [00641 Figure 11: Anti-VEGF antibodies 219R0302 and 219R0202 inhibit tumor growth in PE13 breast tumor xenograft model. Mice were subcutaneously injected on the right flank with 300,000 viable PE13 cells. 219R0302 induced stronger tumor-growth delay than 219R0202. Avastin showed the most potent growth-delay, which was indistinguishable from 219R0302, indicating that 219R0302 and Avastin have nearly equivalent potency in this model. Unlike 219R0302, 219R0202 was statistically different from both Avastin and 219R0302. [00651 Figure 12: Bispecific antibody formats. A) Single Gene Bispecific Antibody (SGBSP). In this format, each light chain is tethered to its respective heavy chain via a 30 amino acid linker (6XGGGGS); B) Monovalent Bispecific Antibody (MBSP). In this -14 format, a common light chain is used, which may be derived from either parental antibody. One or both of the heavy chains must be able to bind its target in combination with a common light chain. [0066] Figure 13: SGBSP and MBSP are greater than 90% heterodimer and homodimer can be eliminated by varying Var3/Varl ratio. A) Protein A purified SGBSP (219R0202_21M18) and MBSP (219R0202 heavy chain (13A/Var3), 21M18 heavy chain (13B/Varl), 21M18 light chain) are >90% pure and contain a small fraction of Varl homodimer (SBBSP: 21M18 SGBSP homodimer (13B/Varl); MBSP: 21M18 heavy chain (13B/Varl) with 21M18 light chain). Lane 1: Standard, Lane 2: 21M18, Lane 3: MBSP, Lane 4: Blank, Lane 5: SGBSP. MBSP heterodimer pI ~ 7.1; MBSP 13A homodimer pI ~ 8.3; MBSP 13B homodimer pI ~ 6.2; SGBSP heterodimer pI ~ 7.8; SGBSP 13A homodimer pI ~ 8.6; SGBSP 13B homodimer pI ~ 6.4. B) The fraction of MBSP 13B/Varl homodimer can be minimized by using at least 2:1 fold molar excess of 219R0202 heavy chain (13A/Var3) to 21M18 heavy chain (13B/Varl). 13A:13B HC Ratio: lane 1, 1:8; lane 2, 1:6; lane 3, 1:4; lane 4, 1:2; lane 5, 1:1; lane 6, 2:1; lane 7, 4:1; lane 8, 6:1; lane 9, 8:1; lane 10, ladder. [00671 Figure 14: SGBSPs partially block VEGF-induced HUVEC proliferation. Both 219R0302_21M18 and 219R0202_21M18 SGBSPs partially inhibited VEGF-induced HUVEC proliferation with the latter showing significantly better activity over the former. [0068] Figure 15: Bispecific antibodies bind well to hDLL4 transfected cells. LZ1, non specific antibody control; SGBSP, 219R0202_21M18 single gene bispecific antibody; MBSP, 219R0202_21M18 monovalent bispecific antibody with common 21M18 LC; Homo 13A, 219R0202 HC (with 13A mutation) expressed only with 21M18 LC; Homo 13B, 21M18 HC (with 13B mutation) expressed only with 21M18 LC. The binding curves were fit to a non-linear transform to yield an EC50 value, which is indicated in parentheses (NF, indicates no fit). [00691 Figure 16: Both SGBSPs and the MBSP bind both VEGF and DLL4 in a bispecific manner. Using the dual targeting assay both 219R0302_21M18 and 219R0202_21M18 both SGBSPs (panel A) and MBSP (panel B) displayed binding to both VEGF and DLL4.
    - 15 [00701 Figure 17: SGBSP shows partial inhibition in VEGF-induced proliferation assay. SGBSP showed partial inhibition of VEGF-induced proliferation compared to the bevacizumab (Avastin) and rhVEGF controls. DETAILED DESCRIPTION OF THE INVENTION [00711 The invention provides methods, compositions, and kits for generating heteromultimeric polypeptides, such as bispecific antibodies. The invention enables the generation of predominately (and in certain embodiments, almost exclusively) heteromultimeric molecules having high yields. Details of methods, compositions, and kits are provided herein. 100721 A "heteromultimer", "heteromultimeric complex", "heteromultimeric polypeptide", or "heteromultimeric molecule" are used interchangeably herein to refer to a molecule comprising at least a first polypeptide and a second polypeptide, wherein the second polypeptide differs in amino acid sequence from the first polypeptide by at least one amino acid residue. The heteromultimer can comprise a "heterodimer" formed by the first and second polypeptide or can form higher order tertiary structures where polypeptides in addition to the first and second polypeptide are present. [00731 Except where indicated otherwise by context, the terms "first" polypeptide and "second" polypeptide, and variations thereof, are merely generic identifiers, and are not to be taken as identifying a specific or a particular polypeptide or component of heteromultimers of the invention. [00741 The terms "polypeptide," "peptide," "protein," and "protein fragment" are used interchangeably herein to refer to a polymer of amino acid residues. The terms apply to amino acid polymers in which one or more amino acid residue is an artificial chemical mimetic of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers and non-naturally occurring amino acid polymers. 100751 The term "amino acid" refers to naturally occurring and synthetic amino acids, as well as amino acid analogs and amino acid mimetics that function similarly to the naturally occurring amino acids. Naturally occurring amino acids are those encoded by the genetic code, as well as those amino acids that are later modified, e.g., hydroxyproline, gamma-carboxyglutamate, and 0-phosphoserine. Amino acid analogs refers to compounds that have the same basic chemical structure as a naturally occurring - 16 amino acid, e.g., an alpha carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, e.g., homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium. Such analogs can have modified R groups (e.g., norleucine) or modified peptide backbones, but retain the same basic chemical structure as a naturally occurring amino acid. Amino acid mimetics refers to chemical compounds that have a structure that is different from the general chemical structure of an amino acid, but that functions similarly to a naturally occurring amino acid. Negatively charged amino acids include aspartic acid (or aspartate) and glutamic acid (or glutamate). Positively charged amino acids include arginine, histidine, and lysine. [00761 As used herein, the terms "antibody" and "immunoglobulin" are used interchangeably in the broadest sense and include monoclonal antibodies (e.g., full length or intact monoclonal antibodies), polyclonal antibodies, multivalent antibodies, multispecific antibodies (e.g., bispecific antibodies so long as they exhibit the desired biological activity) and antibody fragments as described herein. The term "bispecific antibody" is intended to include any antibody that has two different binding specificities, i.e. the antibody binds two different epitopes, which can be located on the same target antigen or, more commonly, on different target antigens. [00771 Native antibodies and immunoglobulins are usually heterotetrameric glycoproteins of about 150,000 daltons, composed of two identical light (L) chains and two identical heavy (H) chains. Each light chain is linked to a heavy chain by one covalent disulfide bond, while the number of disulfide linkages varies between the heavy chains of different immunoglobulin isotypes. Each heavy and light chain also has regularly spaced intrachain disulfide bridges. Each heavy chain has at one end a variable domain (VH) followed by a number of constant domains. Each light chain has a variable domain at one end (VL) and a constant domain at its other end. The constant domain of the light chain is aligned with the first constant domain of the heavy chain, and the light chain variable domain is aligned with the variable domain of the heavy chain. Particular amino acid residues are believed to form an interface between the light and heavy chain variable domains (Clothia et al., J. Mol. Biol. 186, 651-66, 1985); Novotny and Haber, Proc. Natl. Acad. Sci. USA 82, 4592-4596 (1985)). Five human immunoglobulin classes are defined on the basis of their heavy chain composition, and are named IgG, IgM, IgA, IgE, and IgD. The IgG-class and IgA-class antibodies are further divided into subclasses, - 17 namely, IgG1, IgG2, IgG3, and IgG4, and IgAl and IgA2. The heavy chains in IgG, IgA, and IgD antibodies have three constant region domains, that are designated CH1, CH2, and CH3, and the heavy chains in IgM and IgE antibodies have four constant region domains, CHI, CH2, CH3, and CH4. Thus, heavy chains have one variable region and three or four constant regions. Immunoglobulin structure and function are reviewed, for example, in Harlow et al., Eds., Antibodies: A Laboratory Manual, Chapter 14, Cold Spring Harbor Laboratory, Cold Spring Harbor (1988). [0078] "Antibody fragments" comprise only a portion of an intact antibody, wherein the portion preferably retains at least one, preferably most or all, of the functions normally associated with that portion when present in an intact antibody. [00791 The term "monoclonal antibody" as used herein refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible naturally occurring mutations that may be present in minor amounts. Monoclonal antibodies are highly specific and bind a single antigen. Furthermore, in contrast to polyclonal antibody preparations that typically include different antibodies directed against different determinants (epitopes), each monoclonal antibody is directed against a single determinant on the antigen. That an antibody "selectively binds" or "specifically binds" means that the antibody reacts or associates more frequently, more rapidly, with greater duration, with greater affinity, or with some combination of the above to an epitope than with alternative substances, including unrelated proteins. "Selectively binds" or "specifically binds" means, for instance, that an antibody binds to a protein with a KD of at least about 0.1 mM, but more usually at least about 1 tM. "Selectively binds" or "specifically binds" means at times that an antibody binds to a protein at times with a KD of at least about 0.1 pM or better, and at other times at least about 0.01 ptM or better. Because of the sequence identity between homologous proteins in different species, specific binding can include an antibody that recognizes a tumor cell marker protein in more than one species. [0080] The term "epitope" or "antigenic determinant" are used interchangeably herein and refer to that portion of an antigen capable of being recognized and specifically bound by a particular antibody. When the antigen is a polypeptide, epitopes can be formed both from contiguous amino acids and noncontiguous amino acids juxtaposed by tertiary folding of a protein. Epitopes formed from contiguous amino acids are typically retained - 18 upon protein denaturing, whereas epitopes formed by tertiary folding are typically lost upon protein denaturing. An epitope typically includes at least 3, and more usually, at least 5 or 8-10 amino acids in a unique spatial conformation. [00811 The antibodies herein specifically include "chimeric" antibodies in which a portion of the heavy and/or light chain is identical with or homologous to corresponding sequences in antibodies derived from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is identical with or homologous to corresponding sequences in antibodies derived from another species or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as they exhibit the desired biological activity (U.S. Patent No. 4,816,567; and Morrison et al, Proc. Natl. Acad. Sci. USA 81:6851-6855 (1984)). [0082] "Humanized" forms of non-human (e.g., murine) antibodies are chimeric antibodies that contain minimal sequence derived from non-human immunoglobulin. For the most part, humanized antibodies are human immunoglobulins (recipient antibody) in which residues from a hypervariable region of the recipient are replaced by residues from a hypervariable region of a non-human species (donor antibody) such as mouse, rat, rabbit or nonhuman primate having the desired specificity, affinity, and capacity. In some instances, framework region (FR) residues of the human immunoglobulin are replaced by corresponding non-human residues. Furthermore, humanized antibodies can comprise residues that are not found in the recipient antibody or in the donor antibody. These modifications are made to further refine antibody performance. In general, the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable loops correspond to those of a non- human immunoglobulin and all or substantially all of the FRs are those of a human immunoglobulin sequence. The humanized antibody optionally will also comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin. For further details, see Jones et al, Nature 321:522-525 (1986); Riechmann et al, Nature 332:323-329 (1988); and Presta, Curr. Op. Struct. Biol. 2:593 596 (1992). See also the following review articles and references cited therein: Vaswani and Hamilton, Ann. Allergy, Asthma & Immunol. 1:105-115 (1998); Harris, Biochem. Soc. Transactions 23: 1035-1038 (1995); Hurle and Gross, Curr. Op. Biotech. 5:428-433 (1994).
    -19 [00831 A "human antibody" is one that possesses an amino acid sequence that corresponds to that of an antibody produced by a human and/or has been made using any of the techniques for making human antibodies as disclosed herein. This definition of a human antibody specifically excludes a humanized antibody comprising non-human antigen-binding residues. [00841 An "affinity matured" antibody is one with one or more alterations in one or more CDRs thereof that result in an improvement in the affinity of the antibody for antigen, compared to a parent antibody that does not possess those alteration(s). Preferred affinity matured antibodies will have nanomolar or even picomolar affinities for the target antigen. Affinity matured antibodies are produced by procedures known in the art. Marks et al., Bio/Technology 10:779-783 (1992), describes affinity maturation by VH and VL domain shuffling. Random mutagenesis of CDR and/or framework residues is described by: Barbas et al. Proc Nat. Acad. Sci, USA 91 :3809- 3813 (1994); Schier et al. Gene 169:147-155 (1995); Yelton et al. J. Immunol. 155:1994-2004 (1995); Jackson et al., J. Immunol. 154(7):3310-9 (1995); and Hawkins et al, J. Mol. Biol. 226:889-896 (1992). [0085] The term "Fc region", as used herein, generally refers to a dimer complex comprising the C-terminal polypeptide sequences of an immunoglobulin heavy chain, wherein a C-terminal polypeptide sequence is that which is obtainable by papain digestion of an intact antibody. The Fc region can comprise native or variant Fc sequences. Although the boundaries of the Fc sequence of an immunoglobulin heavy chain might vary, the human IgG heavy chain Fc sequence is usually defined to stretch from an amino acid residue at about position Cys226, or from about position Pro230, to the carboxyl terminus of the Fc sequence. The Fc sequence of an immunoglobulin generally comprises two constant domains, a CH2 domain and a CH3 domain, and optionally comprises a CH4 domain. By "Fe polypeptide" herein is meant one of the polypeptides that make up an Fc region. An Fc polypeptide can be obtained from any suitable immunoglobulin, such as IgG1, IgG2, IgG3, or IgG4 subtypes, IgA, IgE, IgD, or IgM. In some embodiments, an Fe polypeptide comprises part or all of a wild type hinge sequence (generally at its N terminus). In some embodiments, an Fc polypeptide does not comprise a functional or wild type hinge sequence. [00861 The "hinge region," "hinge sequence", and variations thereof, as used herein, includes the meaning known in the art, which is illustrated in, for example, Janeway et al., - 20 Immuno Biology: the immune system in health and disease, (Elsevier Science Ltd., NY) (4th ed., 1999); Bloom et al., Protein Science (1997), 6:407-415; Humphreys et al., J. Immunol. Methods (1997), 209:193- 202. [00871 As used herein, the term "hybridizes under stringent conditions" is intended to describe conditions for hybridization and washing under which nucleotide sequences at least 60% homologous to each other typically remain hybridized to each other. In some embodiments, the conditions are such that sequences at least about 70%, at least about 80%, at least about 85% or 90% homologous to each other typically remain hybridized to each other. Such stringent conditions are known to those skilled in the art and can be found in Current Protocols in Molecular Biology, John Wiley & Sons, N.Y. (1989), 6.3.1 6.3.6. A non-limiting example of stringent hybridization conditions are hybridization in 6xsodium chloride/sodium citrate (SSC) at about 45 0 C, followed by one or more washes in 0.2xSSC, 0.1% SDS at 50-65C. [00881 The term "cytotoxin" or "cytotoxic agent" as used herein refers to a substance that inhibits or prevents the function of cells and/or causes destruction of cells. The term is intended to include radioactive isotopes (e.g., Atm , 1125, Y 90 , Re8, Re "8, Sm 153 , Bi 2 12 p 32 and radioactive isotopes of Lu), chemotherapeutic agents e.g. methotrexate, adriamicin, vinca alkaloids (vincristine, vinblastine, etoposide), doxorubicin, melphalan, mitomycin C, chlorambucil, daunorubicin or other intercalating agents, enzymes and fragments thereof such as nucleolytic enzymes, antibiotics, and toxins such as small molecule toxins or enzymatically active toxins of bacterial, fungal, plant or animal origin, including fragments and/or variants thereof, and the various antitumor or anticancer agents disclosed below. Other cytotoxic agents are described below. A tumoricidal agent causes destruction of tumor cells. 100891 "Pharmaceutically acceptable" refers to approved or approvable by a regulatory agency of the Federal or a state government or listed in the U.S. Pharmacopeia or other generally recognized pharmacopeia for use in animals, including humans. [00901 "Pharmaceutically acceptable vehicle" refers to a diluent, adjuvant, excipient, or carrier with which at least one antibody of the present disclosure is administered. [00911 As used herein, the term "subject" refers to any animal (e.g., a mammal), including, but not limited to humans, non-human primates, rodents, and the like, which is -21 to be the recipient of a particular treatment. Typically, the terms "subject" and "patient" are used interchangeably herein in reference to a human subject. [00921 The term "therapeutically effective amount" refers to an amount of an antibody, polypeptide, polynucleotide, small organic molecule, or other drug effective to "treat" a disease or disorder in a subject or mammal. In the case of cancer, the therapeutically effective amount of the drug can reduce the number of cancer cells; reduce the tumor size; inhibit or stop cancer cell infiltration into peripheral organs including, for example, the spread of cancer into soft tissue and bone; inhibit and stop tumor metastasis; inhibit and stop tumor growth; relieve to some extent one or more of the symptoms associated with the cancer, reduce morbidity and mortality; improve quality of life; or a combination of such effects. To the extent the drug prevents growth and/or kills existing cancer cells, it can be referred to as cytostatic and/or cytotoxic. [00931 As used herein, the terms "polynucleotide" or "nucleic acid" refer to a polymer composed of a multiplicity of nucleotide units (ribonucleotide or deoxyribonucleotide or related structural variants) linked via phosphodiester bonds, including but not limited to, DNA or RNA. The term encompasses sequences that include any of the known base analogs of DNA and RNA. including, but not limited to, 4 acetylcytosine, 8-hydroxy-N6 methyladenosine, aziridinylcytosine, pseudoisocytosine, 5-(carboxyhydroxylmethyl) uracil, 5-fluorouracil, 5-bromouracil, 5-carboxymethylaminomethyl 2-thiouracil, 5 carboxymethylaminomethyluracil, dihydrouracil, inosine, N6-isopentenyladenine, 1 methyladenine, 1 -methylpseudouracil, 1 -methylguanine, 1 -methylinosine, 2,2 dimethylguanine, 2-methyladenine, 2-methylguanine, 3-methylcytosine, 5 methyleytosine, N6-methyladenine, 7-methylguanine, 5-methylaminomethyluracil, 5 methoxyaminomethyl-2-thiouracil, beta-D-mannosylqueosine, 5' methoxycarbonylmethyluracil, 5-methoxyuracil, 2-methylthio-N6-isopentenyladenine, uracil-5-oxyacetic acid methylester, uracil-5-oxyacetic acid, oxybutoxosine, pseudouracil, queosine, 2-thiocytosine, 5-methyl-2 thiouracil, 2-thiouracil, 4-thiouracil, 5-methyluracil, N-uracil 5-oxyacetic acid methylester, uracil 5-oxyacetic acid, pseudouracil, queosine, 2 thiocytosine, and 2,6-diaminopurine. [00941 The term "vector," as used herein, is intended to refer to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked. One type of vector is a "plasmid", that refers to a circular double stranded DNA loop into which - 22 additional DNA segments can be ligated. Another type of vector is a phage vector. Another type of vector is a viral vector, wherein additional DNA segments can be ligated into the viral genome. Certain vectors are capable of autonomous replication in a host cell into which they are introduced (e.g., bacterial vectors having a bacterial origin of replication and episomal mammalian vectors). Other vectors (e.g., non-episomal mammalian vectors) can be integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome. Moreover, certain vectors are capable of directing the expression of genes to which they are operatively linked. Such vectors are referred to herein as "recombinant expression vectors" (or simply, "recombinant vectors"). In general, expression vectors of utility in recombinant DNA techniques are often in the form of plasmids. In the present specification, "plasmid" and "vector" can be used interchangeably as the plasmid is the most commonly used form of vector. [0095] The heteromultimeric polypeptides of the present invention can be used to treat a variety of disorders. A "disorder" is any condition that would benefit from treatment with an antibody or method of the invention. This includes chronic and acute disorders or diseases including those pathological conditions that predispose the mammal to the disorder in question. Non-limiting examples of disorders to be treated herein include cell proliferative disorders; non-leukemias and lymphoid malignancies; neuronal, glial, astrocytal, hypothalamic and other glandular, macrophagal, epithelial, stromal and blastocoelic disorders; and inflammatory, immunologic and other angiogenesis-related disorders. The terms "cell proliferative disorder" and "proliferative disorder" refer to disorders that are associated with some degree of abnormal cell proliferation. In one embodiment, the cell proliferative disorder is cancer. "Tumor", as used herein, refers to all neoplastic cell growth and proliferation, whether malignant or benign, and all pre cancerous and cancerous cells and tissues. [00961 In general, specific antigens are used as targets for the heteromultimeric polypeptides of the invention. In one embodiment, the antigen is a tumor antigen. A "tumor antigen," as used herein, includes any molecule that is differentially expressed on a tumor cell compared to a normal cell. In some embodiments, the molecule is expressed at a detectably or significantly higher or lower level in a tumor cell compared to a normal cell. In some embodiments, the molecule exhibits a detectably or significantly higher or - 23 lower level of biological activity in a tumor cell compared to a normal cell. In some embodiments, the molecule is known or thought to contribute to a tumorigenic characteristic of the tumor cell. Numerous tumor antigens are known in the art. Whether a molecule is a tumor antigen can also be determined according to techniques and assays well known to those skilled in the art, such as for example clonogenic assays, transformation assays, in vitro or in vivo tumor formation assays, gel migration assays, gene knockout analysis, etc. [00971 The terms "cancer" or "cancerous" refer to or describe the physiological condition in mammals that is typically characterized by unregulated cell growth/proliferation. Examples of cancer include but are not limited to, carcinoma, lymphoma (e.g., non Hodgkin's lymphoma), blastoma, sarcoma, and leukemia. More particular examples of such cancers include squamous cell cancer, small-cell lung cancer, non-small cell lung cancer, adenocarcinoma of the lung, squamous carcinoma of the lung, cancer of the peritoneum, hepatocellular cancer, gastrointestinal cancer, pancreatic cancer, glioblastoma, cervical cancer, ovarian cancer, liver cancer, bladder cancer, hepatoma, breast cancer, colon cancer, colorectal cancer, endometrial or uterine carcinoma, salivary gland carcinoma, kidney cancer, liver cancer, prostate cancer, vulval cancer, thyroid cancer, hepatic carcinoma and various types of head and neck cancer. [00981 As used herein, "treatment" refers to clinical intervention in an attempt to alter the natural course of the individual or cell being treated, and can be performed either for prophylaxis or during the course of clinical pathology. Desirable effects of treatment include preventing occurrence or recurrence of disease, alleviation of symptoms, diminishment of any direct or indirect pathological consequences of the disease, preventing metastasis, decreasing the rate of disease progression, amelioration or palliation of the disease state, and remission or improved prognosis. In some embodiments, antibodies of the invention are used to delay development of a disease or disorder. [0099] An "effective amount" refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired therapeutic or prophylactic result. A "therapeutically effective amount" of an antibody of the invention can vary according to factors such as the disease state, age, sex, and weight of the individual, and the ability of the antibody to elicit a desired response in the individual. A therapeutically effective -24 amount is also one in which any toxic or detrimental effects of the antibody are outweighed by the therapeutically beneficial effects. [00100] In one aspect, the invention provides heteromultimeric polypeptides that contain substitutions within their immunoglobulin Fe CH3 domain, wherein the substitutions promote heterodimerization. These substitutions comprise replacement of at least one amino acid in one of the CH3 domain containing polypeptides. In one embodiment, the amino acid that is substituted is a charged amino acid, or a hydrophobic/hydrophilic amino acid. [001011 In certain embodiments, substitutions within the first or second polypeptides of the present invention occur within at least one amino acid in which the side chain projects from or is otherwise positioned at the interface of a first polypeptide with the second polypeptide and is therefore positioned to interact with an amino acid of the second polypeptide that is also positioned at the interface of the two polypeptides. By "interface" is meant the place at which independent polypeptides come into contact with one another. Predicted examples of amino acids located at the interface of two CH3 domain containing polypeptides are shown in Table 1. In one embodiment, changing the amino acid side chain so that the electrostatic interaction between the first and second polypeptides is altered, serves to stabilize the heteromultimer, and thereby favor heteromultimer formation over homomultimer formation. Homomultimer molecules will contain like charged molecules and will naturally repel one another. Heteromultimer molecules contain amino acid pairings having side chains that will attract, thus favoring heteromultimer formation. [00102] In one aspect, the present invention demonstrates that substitution of one or more of the amino acids located at positions 236, 245, 249, 278, 286, and 288, in one of the CH3 domain-containing polypeptides, leads to preferential heteromultimer formation, relative to the amount of homodimer formed. The amino acid positions listed above are positions located within the CH3 domain of IgG2 when the amino acids are numbered beginning with the start of the human IgG2 heavy chain constant domain (i.e., the N terminus of the CH1 sequence). Amino acid position is variable within the four IgG isotypes, as well as between IgG, IgA, and IgD. Therefore, the specific amino acid positions are not meant to be limiting to the amino acid located at that specific position in any one immunoglobulin, but rather are meant to encompass the amino acid residues in - 25 all immunoglobulin isotypes at positions corresponding to those mentioned for the human IgG2 CH3 domain. Such variability of amino acid positioning within the four IgG isotypes is shown in Table 1, and graphically shown in Figures 2-4. [00103] Preferential formation of heteromultimeric polypeptides is accomplished by selecting substitutions that differ significantly in their effect on maintaining the charge and/or hydrophobicity of the polypeptide at the target site. Amino acids can be grouped according to similarities in the properties of their side chains (in A.L. Lehninger, in Biochemistry, second ed., pp. 73-75, Worth Publishers, New York (1975)): (1) non-polar: Ala (A), Val (V), Len (L), Ile (I), Pro (P), Phe (F), Trp (W), Met (M) (2) uncharged polar: Gly (G), Ser (S), Thr (T), Cys (C), Tyr (Y), Asn (N), Gln (Q) (3) acidic: Asp (D), Glu (E) (4) basic: Lys (K), Arg (R), His (H) [001041 Alternatively, naturally occurring residues can be divided into groups based on common side-chain properties: (1) hydrophobic: Norleucine, Met, Ala, Val, Leu, Ile; (2) neutral hydrophilic: Cys, Ser, Thr, Asn, Gln; (3) acidic: Asp, Glu; (4) basic: His, Lys, Arg; (5) residues that influence chain orientation: Gly, Pro; (6) aromatic: Trp, Tyr, Phe. [001051 In some embodiments of the invention, amino acids having basic side chains are replaced with amino acids having acidic side chains, or vice versa. For example, the basic amino acids lysine, arginine, or histidine are replaced with aspartic acid or glutamic acid. [001061 In some embodiments, a hydrophilic amino acid (or at least a relatively hydrophilic amino acid) is substituted with a hydrophobic amino acid. An example of this type of substitution is replacement of a tyrosine residue with a phenylalanine. In certain embodiments, the replacement results in the removal of aa hydroxyl side chain at a specific amino acid position at or near the interface between CH3 domain-containing polypeptides and increasing the hydrophobicity at that site.
    - 26 [00107] As used herein, "Var3" and "13A" are used interchangeably to describe a variant containing a substitution of lysine for glutamate at position 236 and a lysine for aspartate at position 278. Also as used herein, "Varl" and "13B" are used interchangeably to describe a variant containing a substitution of glutamate for lysine at position 249 and a glutamate for lysine at position 288. [001081 In one embodiment, the nucleic acid encoding an amino acid located at the interface is altered for the first polypeptide to change the charge of the amino acid ion pairing. To achieve this, the nucleic acid encoding at least one "original" amino acid residue in the interface of the first polypeptide is replaced with a nucleic acid encoding at least one amino acid residue that has an oppositely charged side chain relative to the original amino acid residue. It will be appreciated that there can be more than one original and corresponding substituted residue. The upper limit for the number of original residues that are replaced is the total number of residues in the interface of the first and second polypeptide. [001091 By "original nucleic acid" is meant the nucleic acid encoding a first or second polypeptide that can be "altered" (i.e. genetically engineered). The original or starting nucleic acid can be a naturally occurring nucleic acid or can comprise a nucleic acid that has been subjected to prior alteration (e.g. a humanized antibody fragment). By "altering" the nucleic acid is meant that the original nucleic acid is modified by replacing at least one codon encoding an amino acid residue of interest. Techniques for genetically modifying a DNA in this manner have been reviewed in Mutagenesis: a Practical Approach, MJ. McPherson, Ed., (IRL Press, Oxford, UK. (1991), and include site directed mutagenesis, cassette mutagenesis and polymerase chain reaction (PCR) mutagenesis, for example. By modifying an original nucleic acid, an original polypeptide encoded by the original nucleic acid is thus correspondingly altered. [001101 In one embodiment of the invention, the heteromultimeric polypeptide is a bispecific antibody. In certain embodiments, the bispecific antibody contains the first polypeptide that is a heavy chain polypeptide paired with a light chain polypeptide, and the second polypeptide that is a second heavy chain polypeptide paired with a second light chain polypeptide.
    -27 [001111 Heteromultimeric polypeptides with more than two valencies are contemplated. For example, trispecific antibodies can also be prepared using the methods described herein. (Tutt et al., J. Immunol., 147:60 (1991)). [00112] In one embodiment of the present invention, the method comprises producing a heteromultimeric molecule, such as a bispecific antibody, that utilizes a single light chain that can pair with both heavy chain variable domains present in the bispecific molecule. To identify this light chain, various strategies can be employed. In one embodiment, a series of monoclonal antibodies are identified to each antigen that can be targeted with the bispecific antibody, followed by a determination of which of the light chains utilized in these antibodies is able to function when paired with the heavy chain any of the antibodies identified to the second target. In this manner a light chain that can function with two heavy chains. to enable binding to both antigens can be identified. In another embodiment, display techniques, such as phage display, can enable the identification of a light chain that can function with two or more heavy chains. In one embodiment, a phage library is constructed which consists of a diverse repertoire of heavy chain variable domains and a single light chain variable domain. This library can further be utilized to identify antibodies that bind to various antigens of interest. Thus, in certain embodiments, the antibodies identified will share a common light chain. [001131 In certain embodiments of the present invention, the heteromultimeric polypeptides comprise at least one single chain Fv (scFv). In certain embodiments the heteromultimeric polypeptide comprise two scFvs. For example, a scFv may be fused to one or both of a CH3 domain-containing polypeptide contained within a heteromultimeric polypeptide. Some methods comprise producing a bispecific molecule wherein one or both of the heavy chain constant regions comprising at least a CH3 domain is utilized in conjunction with a single chain Fv domain to provide antigen binding. 1001141 The heteromultimeric molecules can comprise two antigen binding arms of different specificity. For example, heteromultimeric molecules can be generated comprising a first polypeptide which is an antigen binding arm (such as a classical immunoglobulin molecule) and a second polypeptide that is an immunoglobulin fusion protein. An example of immunoglobulin fusion proteins useful in the present invention are immunoadhesins.
    - 28 [00115] As used herein, the term "immunoadhesin" designates antibody-like molecules that combine the "binding domain" of a heterologous protein (an "adhesin", e.g. a receptor, ligand or enzyme) with the effector component of immunoglobulin constant domains. Structurally, immunoadhesins comprise a fusion of the adhesin amino acid sequence with the desired binding specificity, that is other than the antigen recognition and binding site (antigen combining site) of an antibody (i.e. is "heterologous") and an immunoglobulin constant domain sequence. The immunoglobulin constant domain sequence in the immunoadhesin can be obtained from any immunoglobulin, such as IgG1, IgG2, IgG3, or IgG4 subtypes, IgA, IgE, IgD or IgM. [001161 The heteromultimeric polypeptides of the invention can be generated to bind any antigen(s). In some embodiments, the heteromultimeric polypeptides bind one or more antigens selected from the group consisting of: DLL4, VEGF, VEGFR2, Notch1, Notch2, Notch3, Notch4, Notch(pan), JAGI, JAG2, DLL(pan), JAG(pan), EGFR, ERBB2, ERBB3, ERBB(pan), c-Met, IGF-1R, PDGFR, Patched, Hedgehog family polypeptides, Hedgehog(pan), WNT family polypeptides, WNT(pan), FZD1, FZD2, FZD3, FZD4, FZD5, FZD6, FZD7, FZD8, FZD9, FZD1O, FZD(pan), LRP5, LRP6, CD20, IL-6, TNFalpha, IL-23, IL-17, CD80, CD86, CD3, CEA, Mucl6, PSMA, PSCA, CD44, c-Kit, DDR1, DDR2, RSPO1, RSPO2, RSPO3, RSPO4, RSPO(pan), BMP family polypeptides, BMP(pan), BMPRla, BMPRlb, and a combination thereof. As used herein, "pan" is meant to describe heteromultimeric polypeptides that bind multiple antigens from within the same family. For example, "Notch(pan)" is meant to describe a heteromultimeric polypeptide that binds more than one of the group of Notch1, Notch2, Notch3, or Notch4. [001171 In one embodiment, the heteromultimeric polypeptide specifically binds DLL4 and VEGF. [001181 In one embodiment, one of the polypeptides in a heteromultimeric polypeptide binds DLL4 with the same specificity as the 21M18 antibody described in copending U.S Appl. No. 11/905,392, filed September 28, 2007, which is herein incorporated by reference. [001191 In one embodiment, the invention provides antibodies that binds VEGF. In one embodiment, the invention provides an antibody (219R0302) that specifically binds VEGF, wherein the antibody comprises: (a) a heavy chain CDR1 comprising GYTFTNYWMH (SEQ ID NO:20), a heavy chain CDR2 comprising -29 SINPSNGGTSYNEKFKR (SEQ ID NO:21), and a heavy chain CDR3 comprising HYYDNSYAMDY (SEQ ID NO:22); and/or (b) a light chain CDR1 comprising QASQDISNYVN (SEQ ID NO:23), a light chain CDR2 comprising DASNLQT (SEQ ID NO:24), and a light chain CDR3 comprising QQYDDLPP (SEQ ID NO:25). In another embodiment, the invention provides an antibody (219R0202) that specifically binds VEGF, wherein the antibody comprises: (a) a heavy chain CDR1 comprising GYTFTNYWMH (SEQ ID NO:20), a heavy chain CDR2 comprising SINPSNGGTSYNEKFKR (SEQ ID NO:21), and a heavy chain CDR3 comprising HYYDNSYAMDY (SEQ ID NO:22); and/or (b) a light chain CDR1 comprising RASQGINNHLAW (SEQ ID NO:26), a light chain CDR2 comprising AASNLHS (SEQ ID NO:27), and a light chain CDR3 comprising QQYDNLPL (SEQ ID NO:28). [001201 In one embodiment, the VEGF and DLL4 heteromultimeric polypeptides comprise an antibody with the same specificity as 21M18 and either 219R0302 or 219R0202. These heteromultimeric polypeptides can be produced having the light chain linked to the heavy chain, or using an identical light chain. In one embodiment, the antibodies comprise the 13A/13B substitutions, as described herein, in their Fc region. [001211 In one embodiment, the VEGF binding sequence comprises SEQ ID NO:17 or SEQ ID NO:18. In one embodiment, the DLL4 binding sequence comprises SEQ ID NO:19. In another embodiment, the bispecific antibody comprises the VEGF binding sequence comprising heavy chain sequence of SEQ ID NO:11 and the light chain sequence of SEQ ID NO:13 or SEQ ID NO:15; and the DLL4 binding sequence comprising SEQ ID NO:19. In another embodiment, the heteromultimeric polypeptide comprises the VEGF binding sequence comprising heavy chain sequence of SEQ ID NO: 11 and the light chain sequence of SEQ ID NO: 13; and the DLL4 binding sequence comprising SEQ ID NO:19. In a further embodiment, the heteromultimeric polypeptide comprises the VEGF binding sequence comprising heavy chain sequence of SEQ ID NO: 11 and the light chain sequence of SEQ ID NO:15; and the DLL4 binding sequence comprising SEQ ID NO:19. [00122] In another embodiment, the VEGF binding sequence comprises a polypeptide selected from the group consisting of SEQ ID NOs:10, 29, and 30. In one embodiment, the VEGF polypeptide is an antibody.
    - 30 [001231 In some embodiments, the heteromultimeric polypeptides or antibodies are intact antibodies such as monoclonal or humanized antibodies. In another embodiment, they antibodies are antibody fragments, such as Fab or scFv. In one embodiment, the anti VEGF antibodies/polypeptides inhibit tumor growth. [00124] Heteromultimeric polypeptides of the invention can have dual specificity (bivalent) and are capable of binding to two different antigens simultaneously. In one embodiment, the heteromultimeric polypeptides contain two antibody combining sites. In another embodiment, the heteromultimeric polypeptides are bivalent immunoadhesins. The different antigens can be located on different cells or on the same cell. Cross linking of antigen can be shown in vitro, for example by providing a solid surface to which a first antigen has been bound, adding a bispecific antibodies specific for the first antigen and a second antigen for which the binding protein is also specific and detecting the presence of bound second antigen. [001251 Heteromultimeric polypeptides of the invention can, in certain embodiments, block the interaction between two receptors and their respective ligands. For example, a bispecific antibody specific for DLL4 and VEGF inhibits VEGF induced cell migration as well as Notch receptor signaling. In this case, combination of two receptor binding specificities is more efficacious in inhibiting cell migration that the individual parent antibodies. [00126] Heteromultimeric molecules of the invention can also be monovalent, meaning they have one antigen binding site. In one embodiment, the monovalent heteromultimeric polypeptides possess one variable domain, and the second CH3 domain containing polypeptide is truncated such that it does not contain a variable domain. These second CH3 domain containing polypeptides can possess a detectable label. In one embodiment, the monovalent heteromultimeric polypeptide contains a FLAG epitope. The FLAG epitope is a synthetic epitope that consists of eight amino acid residues (DYKDDDDK). In another embodiment, the monovalent heteromultimeric polypeptide is an immunoadhesin. [001271 In one embodiment, the heteromultimeric molecules of the invention are produced in a first format called single gene bispecific (SGBSP). To generate SBGSPs, a 30 amino acid linker is used to genetically tether, or link, the light chain to its heavy chain (see, Lee et al. Mol. Immunol. 36:61-71 (1999). Therefore, each SGBSP binding unit can use its -31 own light chain to form a Fab binding unit that binds its respective target. In one embodiment, the single genes also comprise the Var3/13A and Varl/13B mutations. In one embodiment, anti-DLL4 and anti-VEGF antibodies are used to produce SGBSPs. In one embodiment, the 21M18 and 219R0302/219R0202 heavy chains are produced as SGBSP. In a further embodiment, the 21M18 and 219R0302/219R0202 heavy chains are cloned with the 13B and 13A mutants, respectively. [001281 In another embodiment, the heteromultimeric molecules of the invention are produced in a second format called monovalent bispecific (MBSP). MBSPs use a common light chain with two different heavy chains that comprise the Var3/13A and Varl/13B mutations. For MBSPs, one or both of the heavy chains must bind its target in combination with a common light chain. In some embodiments, the common light chain is the parental light chain for one of the heavy chains. In one embodiment, anti-DLL4 and anti-VEGF antibodies are used to produce SGBSPs. In one embodiment, the 21M18 and 219R0302/219R0202 heavy chains are produced as SGBSP. In a further embodiment, the 21M18 and 219R0302/219R0202 heavy chains are cloned with the 13B and 13A mutants, respectively. [001291 To express heteromultimeric molecules of the invention with selected or random combinations of VL and VH domains, V genes encoding those domains are assembled into a bacterial expression vector. For example, a vector can be used that has sequences encoding a bacterial secretion signal sequence and a peptide linker and that has convenient restriction sites for insertion of VL and VH genes. Alternatively, it might be desired to first assemble all necessary coding sequences (e.g., secretion signal, VL, VH and linker peptide) into a single sequence, for example by PCR amplification using overlapping primers, followed by ligation into a plasmid or other vector. Where it is desired to provide a specific combination of VL and VH domains, PCR primers specific to the sequences encoding those domains are used. Where it is desired to create diverse combinations of a large number of VL and VH domain, mixtures of primers are used to amplify multiple sequences. [001301 Vectors for construction and expression of heteromultimeric polypeptides of the invention in bacteria are available that contain secretion signal sequences and convenient restriction cloning sites. VL and VH gene combinations encoding binding sites specific for a particular antigen are isolated from cDNA of B cell hybridomas. Alternatively, random - 32 combinations of VL and VH genes are obtained from genomic DNA and the products then screened for binding to an antigen of interest. Typically, the polymerase chain reaction (PCR) is employed for cloning, using primers that are compatible with restriction sites in the cloning vector. See, e.g., Dreher, M. L. et al. (1991) J. Immunol. Methods 139:197 205; Ward, E. S. (1993) Adv. Pharmacol. 24:1-20; Chowdhury, P. S. and Pastan, I. (1999) Nat. Biotechnol. 17:568-572. [00131] In one embodiment, the invention provides polynucleotides that express the polypeptides or antibodies described herein. In one embodiment, the invention provides polynucleotides that hybridize under stringent conditions to the polynucleotides that encode the polypeptides or antibodies of the invention. In one embodiment, the polynucleotide comprise the sequences of SEQ ID NOs: 12, 14, or 16. [001321 In one embodiment, bispecific antibodies of the invention are made by expressing 1) a first polypeptide comprising a heavy chain variable domain corresponding to a first specificity connected to a light chain variable domain of a second specificity; and 2) a second polypeptide comprising a light chain variable domain corresponding to the first specificity connected to the heavy chain variable domain of the second specificity. [00133] For certain heteromultimeric polypeptides of the invention, expression in other host cells may be desired. For example, heteromultimeric polypeptides comprising constant domains are often more efficiently expressed in eukaryotic cells, including yeast, insect, vertebrate and mammalian cells. It will be necessary to use such cells where it is desired that the expressed product be glycosylated. The DNA fragments coding for the first and second polypeptides can be cloned, e.g., into HCMV vectors designed to express human light chains of human heavy chains in mammalian cells. (See, eg., Bendig, et al., U.S. Pat. No. 5,840,299; Maeda, et al. (1991) Hum. Antibod. Hybridomas 2, 124-134). Such vectors contain the human cytomegalovirus (HCMV) promoter and enhancer for high level transcription of the light chain and heavy chain constructs. In a preferred embodiment, the light chain expression vector is pKN1OO (gift of Dr. S. Tarran Jones, MRC Collaborative Center, London, England), that encodes a human kappa light chain, and the heavy chain expression vector is pG1D105 (gift of Dr. S. Tarran Jones), that encodes a human gamma-i heavy chain. Both vectors contain HCMV promoters and enhancers, replication origins and selectable markers functional in mammalian cells and E. coli.
    - 33 [001341 A selectable marker is a gene that encodes a protein necessary for the survival or growth of transformed host cells grown in a selective culture medium. Typical selectable markers encode proteins that (a) confer resistance to antibiotics or other toxins, e.g. ampicillin, neomycin, methotrexate, or tetracycline, (b) complement auxotrophic deficiencies, or (c) supply critical nutrients not available from complex media, e.g. the gene encoding D-alanine racemase for Bacilli. A particularly useful selectable marker confers resistance to methotrexate. For example, cells transformed with the DHFR selection gene are first identified by culturing all of the transformants in a culture medium that contains methotrexate (Mtx), a competitive antagonist of DHFR. An appropriate host cell when wild-type DHFR is employed is the Chinese hamster ovary (CHO) cell line deficient in DHFR activity, prepared and propagated as described by Urlaub and Chasin (1980) Proc. Natl. Acad. Sci. USA 77, 4216. The transformed cells are then exposed to increased levels of methotrexate. This leads to the synthesis of multiple copies of the DHFR gene, and, concomitantly, multiple copies of other DNA comprising the expression vectors, such as the DNA encoding the antibody or antibody fragment. In another example, mutant myeloma cells that are deficient for thymidine kinase (TK) are unable to use exogenously supplied thymidine when aminopterin is used to block DNA synthesis. Useful vectors for transfection carry an intact TK gene that allows growth in media supplemented with thymidine. [001351 Where it is desired to express a gene construct in yeast, a suitable selection gene for use in yeast is the trpl gene present in the yeast plasmid YRp7. Stinchcomb et al., 1979 Nature, 282, 39; Kingsman et al., 1979, Gene 7, 141. The trpl gene provides a selection marker for a mutant strain of yeast lacking the ability to grow in tryptophan, for example, ATCC No.44076 or PEP4-1. Jones (1977) Genetics 85,12. The presence of the tip I lesion in the yeast host cell genome then provides an effective environment for detecting transformation by growth in the absence of tryptophan. Similarly, Leu2 deficient yeast strains (ATCC 20,622 or 38,626) are complemented by known plasmids bearing the Leu2 gene. [001361 Preferred host cells for transformation of vectors and expression of antibodies of the present invention are bacterial cells, yeast cells and mammalian cells, e.g., COS-7 cells, chinese hamster ovary (CHO) cells, and cell lines of lymphoid origin such as lymphoma, myeloma, or hybridoma cells. The transformed host cells are cultured by -34 methods known in the art in a liquid medium containing assimilable sources of carbon, e.g. carbohydrates such as glucose or lactose, nitrogen, e.g. amino acids, peptides, proteins or their degradation products such as peptones, ammonium salts or the like, and inorganic salts, e.g. sulfates, phosphates and/or carbonates of sodium, potassium, magnesium and calcium. The medium furthermore contains, for example, growth promoting substances, such as trace elements, for example iron, zinc, manganese and the like. [001371 The heteromultimeric molecules find use in the diagnostic and therapeutic methods described herein. In certain embodiments, the molecules of the present invention are used to detect the expression of a tumor cell marker protein in biological samples such as, for example, a patient tissue biopsy, pleural effusion, or blood sample. Tissue biopsies can be sectioned and protein detected using, for example, immunofluorescence or immunohistochemistry. In addition, individual cells from a sample can be isolated, and protein expression detected on fixed or live cells by FACS analysis. In certain embodiments, heteromultimeric molecules can be used on protein arrays to detect expression of a tumor cell marker, for example, on tumor cells, in cell lysates, or in other protein samples. In certain embodiments, the heteromultimeric molecules of the present invention are used to inhibit the growth of tumor cells by contacting the heteromultimeric molecules with tumor cells in in vitro cell based assays, in vivo animal models, etc. In certain embodiments, the heteromultimeric molecules are used to treat cancer in a patient by administering a therapeutically effective amount of an heteromultimeric molecule against one or more tumor cell markers. [00138] In some embodiments of the present invention, the heteromultimeric molecule is a humanized bispecific antibody. Humanized antibodies are antibodies that contain minimal sequences from non-human (e.g rodent) antibodies within the antigen determination or hypervariable region that comprise the three complementary determination regions (CDRs) within each antibody chain. Such antibodies are used therapeutically to reduce antigenicity and HAMA (human anti-mouse antibody) responses when administered to a human subject. In practice, humanized antibodies are typically human antibodies with minimum to virtually no non-human sequences. A human antibody is an antibody produced by a human or an antibody having an amino acid sequence corresponding to an antibody produced by a human.
    - 35 [001391 Humanized antibodies can be produced using various techniques known in the art. An antibody can be humanized by substituting the CDRs of a human antibody with those of a non-human antibody (e.g. mouse, rat, rabbit, hamster, etc.) having the desired specificity, affinity, and capability following the methods of Jones et al., 1986, Nature, 321:522-525; Riechmann et al., 1988, Nature, 332:323-327; Verhoeyen et al., 1988, Science, 239:1534-1536. The humanized antibody can be further modified by the substitution of additional residue either in the variable human framework region and/or within the replaced non-human residues to refine and optimize antibody specificity, affinity, and/or capability. [00140] The choice of human heavy and/or light chain variable domains to be used in making humanized antibodies can be important for reducing antigenicity. According to the "best-fit" method, the sequence of the variable domain of a rodent antibody is screened against the entire library of known human variable-domain amino acid sequences. Thus in certain embodiments, the human amino acid sequence that is most homologous to that of the rodent antibody from which the CDRs are taken is used as the human framework region (FR) for the humanized antibody (Sims et al., 1993, J. Immunol., 151: 2296; Chothia et al., 1987, J. Mol. Biol., 196: 901). Another method uses a particular FR derived from the consensus sequence of all human antibodies of a particular subgroup of light or heavy chains and can be used for several difference humanized antibodies (Carter et al., 1992, PNAS, 89; 4285; Presta et al., 1993, J Immunol., 151: 2623). In certain embodiments, a combination of methods is used to pick the human variable FR to use in generation of humanized antibodies. [001411 It is further understood that antibodies (e.g. rodent) to be humanized must retain high affinity for the antigen as well as other favorable biological properties. To achieve this goal, humanized antibodies can be prepared by a process of analysis of the parental sequence from the rodent antibody to be humanized and the various candidate humanizing sequences. Three-dimensional immunoglobulin models are available and familiar to those skilled in the art. Computer programs can be used to illustrate and display probable three-dimensional conformational structures of selected candidate antibody sequences. Use of such models permits analysis of the likely role of the residues in the function of the antibody to be humanized, i.e., the analysis of residues that influence the ability of the candidate antibody to bind its antigen. In this way, FR -36 residues can be selected and combined from the parental antibody to the recipient humanized antibody so that the desired antibody characteristics are achieved. In general, the residues in the CDRs of the antigen determination region (or hypervariable region) are retained from the parental antibody (e.g. the rodent antibody with the desired antigen binding properties) in the humanized antibody for antigen binding. In certain embodiments, at least one additional residue within the variable FR is retained from the parental antibody in the humanized antibody. In certain embodiments, up to six additional residues within the variable FR are retained from the parental antibody in the humanized antibody. [001421 Amino acids from the variable regions of the mature heavy and light chains of immunoglobulins are designated Hx and Lx respectively, where x is a number designating the position of an amino acid according to the scheme of Kabat, Sequences of Proteins of Immunological Interest, U.S. Department of Health and Human Services, 1987, 1991. Kabat lists many amino acid sequences for antibodies for each subgroup, and lists the most commonly occurring amino acid for each residue position in that subgroup to generate a consensus sequence. Kabat uses a method for assigning a residue number to each amino acid in a listed sequence, and this method for assigning residue numbers has become standard in the field. Kabat's scheme is extendible to other antibodies not included in his compendium by aligning the antibody in question with one of the consensus sequences in Kabat by reference to conserved amino acids. The use of the Kabat numbering system readily identifies amino acids at equivalent positions in different antibodies. For example, an amino acid at the L50 position of a human antibody occupies the equivalent position to an amino acid position L50 of a mouse antibody. Moreover, any two antibody sequences can be uniquely aligned, for example to determine percent identity, by using the Kabat numbering system so that each amino acid in one antibody sequence is aligned with the amino acid in the other sequence that has the same Kabat number. In some embodiments, after alignment, if a subject antibody region (e.g., the entire mature variable region of a heavy or light chain) is being compared with the same region of a reference antibody, the percentage sequence identity between the subject and reference antibody regions is the number of positions occupied by the same amino acid in both the subject and reference antibody region divided by the total number of - 37 aligned positions of the two regions, with gaps not counted, multiplied by 100 to convert to percentage. [001431 In addition to humanized antibodies, fully human antibodies can be directly prepared using various techniques known in the art. Immortalized human B lymphocytes immunized in vitro or isolated from an immunized individual that produce an antibody directed against a target antigen can be generated (See, e.g., Cole et al., Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, p. 77 (1985); Boemer et al., 1991, J. Immunol., 147 (1):86-95; and U.S. Patent 5,750,373). Also, the human antibody can be selected from a phage library, where that phage library expresses human antibodies (Vaughan et al., 1996, Nat. Biotech., 14:309-314; Sheets et al., 1998, Proc. Nat'l. Acad. Sci., 95:6157-6162; Hoogenboom and Winter, 1991, J. Mol. Biol., 227:381; Marks et al., 1991, J Mol. Biol., 222:581). Human antibodies can also be made in transgenic mice containing human immunoglobulin loci that are capable upon immunization of producing the full repertoire of human antibodies in the absence of endogenous immunoglobulin production. This approach is described in U.S. Patents 5,545,807; 5,545,806; 5,569,825; 5,625,126; 5,633,425; and 5,661,016. [00144] This invention also encompasses bispecific antibodies that specifically recognize an antigen of interest, including but not limited to a tumor cell marker. Bispecific antibodies are antibodies that are capable of specifically recognizing and binding at least two different epitopes (See, e.g., Wu et al., Simultaneous Targeting of Multiple Disease Mediators by a Dual-Variable-Domain Immunoglobulin, Nature Biotech., 25(11):1290 97). The different epitopes can either be within the same molecule (e.g. the same tumor marker polypeptide) or on different molecules such that both, for example, can specifically recognize and bind a tumor cell marker as well. Bispecific antibodies can be intact antibodies or antibody fragments. [001451 Exemplary bispecific antibodies can bind to two different epitopes. Bispecific antibodies can also be used to direct cytotoxic agents to cells that express a particular antigen. These antibodies possess an antigen-binding arm and an arm that binds a cytotoxic agent or a radionuclide chelator, such as EOTUBE, DPTA, DOTA, or TETA. Techniques for making bispecific antibodies are common in the art (Millstein et al., 1983, Nature 305:537-539; Brennan et al., 1985, Science 229:81; Suresh et al, 1986, Methods in Enzymol. 121:120; Traunecker et al., 1991, EMBO J. 10:3655-3659; Shalaby et al., 1992, - 38 J. Exp. Med. 175:217-225; Kostelny et al., 1992, J. Immunol. 148:1547-1553; Gruber et al., 1994, J. Immunol. 152:5368; and U.S. Patent 5,731,168). Antibodies with more than two valencies are also contemplated. For example, trispecific antibodies can be prepared (Tutt et al., J Immunol. 147:60 (1991)) [001461 In certain embodiments are provided a fragment of the heteromultimeric polypeptide to, for example, increase tumor penetration. Various techniques are known for the production of antibody fragments: Traditionally, these fragments are derived via proteolytic digestion of intact antibodies (for example Morimoto et al., 1993, Journal of Biochemical and Biophysical Methods 24:107-117; Brennan et al., 1985, Science, 229:81). In certain embodiments, antibody fragments are produced recombinantly. Fab, Fv, and scFv antibody fragments can all be expressed in and secreted from E. coli or other host cells, thus allowing the production of large amounts of these fragments. Such antibody fragments can also be isolated from the antibody phage libraries discussed above. The antibody fragment can also be linear antibodies as described in U.S. Patent 5,641,870, for example, and can be monospecific or bispecific. Other techniques for the production of antibody fragments will be apparent to the skilled practitioner. 1001471 It can further be desirable, especially in the case of antibody fragments, to modify a heteromultimeric molecule in order to increase its serum half-life. This can be achieved, for example, by incorporation of a salvage receptor binding epitope into the heteromultimeric molecule by mutation of the appropriate region or by incorporating the epitope into a peptide tag that is then fused to the heteromultimeric molecule at either end or in the middle (e.g., by DNA or peptide synthesis). [001481 For the purposes of the present invention, it should be appreciated that modified antibodies can comprise any type of variable region that provides for the association of the heteromultimer with the polypeptides of interest. In this regard, the variable region can comprise or be derived from any type of mammal that can be induced to mount a humoral response and generate immunoglobulins against the desired tumor associated antigen. As such, the variable region of the modified antibodies can be, for example, of human, murine, non-human primate (e.g. cynomolgus monkeys, macaques, etc.) or lupine origin. In some embodiments both the variable and constant regions of the modified immunoglobulins are human. In other embodiments the variable regions of compatible antibodies (usually derived from a non-human source) can be engineered or specifically -39 tailored to improve the binding properties or reduce the immunogenicity of the molecule. In this respect, variable regions useful in the present invention can be humanized or otherwise altered through the inclusion of imported amino acid sequences. [001491 The variable domains in both the heavy and light chains are altered by at least partial replacement of one or more CDRs and, if necessary, by partial framework region replacement and sequence changing. Although the CDRs can be derived from an antibody of the same class or even subclass as the antibody from which the framework regions are derived, it is envisaged that the CDRs will be derived from an antibody of different class and preferably from an antibody from a different species. It may not be necessary to replace all of the CDRs with the complete CDRs from the donor variable region to transfer the antigen binding capacity of one variable domain to another. Rather, it may only be necessary to transfer those residues that are necessary to maintain the activity of the antigen binding site. Given the explanations set forth in U.S. Pat. Nos. 5,585,089, 5,693,761 and 5,693,762, it will be well within the competence of those skilled in the art, either by carrying out routine experimentation or by trial and error testing to obtain a functional antibody with reduced immunogenicity. [001501 Alterations to the variable region notwithstanding, those skilled in the art will appreciate that the modified heteromultimers of this invention can comprise antibodies, or immunoreactive fragments thereof, in which at least a fraction of one or more of the constant region domains has been deleted or otherwise altered so as to provide desired biochemical characteristics such as increased tumor localization or reduced serum half life when compared with an antibody of approximately the same immunogenicity comprising a native or unaltered constant region. In some embodiments, the constant region of the modified antibodies will comprise a human constant region. Modifications to the constant region compatible with this invention comprise additions, deletions or substitutions of one or more amino acids in one or more domains. That is, the modified heteromultimers disclosed herein can comprise alterations or modifications to one or more of the three heavy chain constant domains (CHI, CH2 or CH3) and/or to the light chain constant domain (CL). In some embodiments of the invention modified constant regions wherein one or more domains are partially or entirely deleted are contemplated. In some embodiments the modified antibodies will comprise domain deleted constructs or variants wherein the entire CH2 domain has been removed (ACH2 constructs). In some - 40 embodiments the omitted constant region domain will be replaced by a short amino acid spacer (e.g. 10 residues) that provides some of the molecular flexibility typically imparted by the absent constant region. [001511 While not limiting the scope of the present invention, it is believed that heteromultimeric polypeptides comprising constant regions modified as described herein provide for altered effector functions that, in turn, affect the biological profile of the administered polypeptide. For example, the deletion or inactivation (through point mutations or other means) of a constant region domain may reduce Fc receptor binding of the circulating modified antibody thereby increasing tumor localization. In other cases it may be that constant region modifications, consistent with this invention, moderate complement binding and thus reduce the serum half life and nonspecific association of a conjugated cytotoxin. Yet other modifications of the constant region can be used to eliminate disulfide linkages or oligosaccharide moieties that allow for enhanced localization due to increased antigen specificity or antibody flexibility. Similarly, modifications to the constant region in accordance with this invention can easily be made using well known biochemical or molecular engineering techniques well within the purview of the skilled artisan. 1001521 The invention also pertains to heteromultimeric molecules comprising a heteromultimeric polypeptide conjugated to a cytotoxic agent. Cytotoxic agents include chemotherapeutic agents, growth inhibitory agents, toxins (e.g., an enzymatically active toxin of bacterial, fungal, plant, or animal origin, or fragments thereof), radioactive isotopes (i.e., a radioconjugate), etc. Chemotherapeutic agents useful in the generation of such immunoconjugates include, for example, methotrexate, adriamicin, doxorubicin, melphalan, mitomycin C, chlorambucil, daunorubicin or other intercalating agents. Enzymatically active toxins and fragments thereof that can be used include diphtheria A chain, nonbinding active fragments of diphtheria toxin, exotoxin A chain, ricin A chain, abrin A chain, modeccin A chain, alpha-sarcin, Aleurites fordii proteins, dianthin proteins, Phytolaca americana proteins (PAPI, PAPII, and PAP-S), momordica charantia inhibitor, curcin, crotin, sapaonaria officinalis inhibitor, gelonin, mitogellin, restrictocin, phenomycin, enomycin, and the tricothecenes. In some embodiments, the heteromultimeric molecules can be conjugated to radioisotopes, such as 9 0 Y, 125 1311 1231,
    '
    1 iIn, Rh, 53 Sm, 6 7 Cu, 67Ga, 166Ho, 17 Lu, 86 Re and 1 88 Re using anyone of a number of -41 well known chelators or direct labeling. In other embodiments, the disclosed compositions can comprise heteromultimeric molecules coupled to drugs, prodrugs or lymphokines such as interferon. Conjugates of the heteromultimeric molecule and cytotoxic agent are made using a variety of bifunctional protein-coupling agents such as N-succinimidyl-3-(2-pyridyidithiol) propionate (SPDP), iminothiolane (IT), bifunctional derivatives of imidoesters (such as dimethyl adipimidate HCL), active esters (such as disuccinimidyl suberate), aldehydes (such as glutareldehyde), bis-azido compounds (such as bis(p-azidobenzoyl) hexanediamine), bis-diazonium derivatives (such as bis-(p diazoniumbenzoyl)-ethylenediamine), diisocyanates (such as tolyene 2,6-diisocyanate), and bis-active fluorine compounds (such as 1,5-difluoro-2,4-dinitrobenzene). Conjugates of an antibody and one or more small molecule toxins, such as a calicheamicin, maytansinoids, a trichothene, and CC1065, and the derivatives of these toxins that have toxin activity, can also be used. In some embodiments, the heteromultimeric polypeptides can be complexed with other immunologically active ligands (e.g. antibodies or fragments thereof) wherein the resulting molecule binds to both the neoplastic cell and an effector cell such as a T cell. 1001531 Regardless of how useful quantities are obtained, the heteromultimeric polypeptides of the present invention can be used in any one of a number of conjugated (i.e. an immunoconjugate) or unconjugated forms. Alternatively, the heteromultimeric polypeptides of this invention can be used in a nonconjugated or "naked" form to harness the subject's natural defense mechanisms including complement-dependent cytotoxicity (CDC) and antibody dependent cellular toxicity (ADCC) to eliminate the malignant cells. The selection of which conjugated or unconjugated heteromultimeric polypeptide to use will depend of the type and stage of cancer, use of adjunct treatment (e.g., chemotherapy or external radiation) and patient condition. It will be appreciated that one skilled in the art could readily make such a selection in view of the teachings herein. [001541 The heteromultimeric polypeptides of the present invention can be assayed for immunospecific binding by any method known in the art. The immunoassays which can be used include, but are not limited to, competitive and non-competitive assay systems using techniques such as BlAcore analysis, FACS analysis, immunofluorescence, immunocytochemistry, Western blots, radioimmunoassays, ELISA, "sandwich" immunoassays, immunoprecipitation assays, precipitin reactions, gel diffusion precipitin - 42 reactions, immunodiffusion assays, agglutination assays, complement-fixation assays, immunoradiometric assays, fluorescent immunoassays, and protein A immunoassays. Such assays are routine and well known in the art (see, e.g., Ausubel et al, eds, 1994, Current Protocols in Molecular Biology, Vol. 1, John Wiley & Sons, Inc., New York, which is incorporated by reference herein in its entirety). [001551 In some embodiments, the immunospecificity of a heteromultimeric polypeptide against a tumor cell marker is determined using ELISA. An ELISA assay comprises preparing antigen, coating wells of a 96 well microtiter plate with antigen, adding the antibody against a tumor cell marker conjugated to a detectable compound such as an enzymatic substrate (e.g. horseradish peroxidase or alkaline phosphatase) to the well, incubating for a period of time and detecting the presence of the antigen. In some embodiments, the heteromultimeric molecule that binds a tumor cell marker is not conjugated to a detectable compound, but instead a second conjugated antibody that recognizes the heteromultimeric polypeptide against a tumor cell marker is added to the well. In some embodiments, instead of coating the well with the antigen, the antibody against a tumor cell marker can be coated to the well and a second antibody conjugated to a detectable compound can be added following the addition of the antigen to the coated well. One of skill in the art would be knowledgeable as to the parameters that can be modified to increase the signal detected as well as other variations of ELISAs known in the art (see e.g. Ausubel et al, eds, 1994, Current Protocols in Molecular Biology, Vol. 1, John Wiley & Sons, Inc., New York at 11.2.1). [001561 The binding affinity of a heteromultimeric polypeptide to a tumor cell antigen and the off-rate of an heteromultimer-antigen interaction can be determined by competitive binding assays. One example of a competitive binding assay is a radioimmunoassay comprising the incubation of labeled antigen (e.g. 3H or 1251), or fragment or variant thereof, with the heteromultimeric polypeptide of interest in the presence of increasing amounts of unlabeled antigen followed by the detection of the heteromultimeric polypeptide bound to the labeled antigen. The affinity of the heteromultimeric polypeptide against a tumor cell marker and the binding off-rates can be determined from the data by scatchard plot analysis. In some embodiments, BlAcore kinetic analysis is used to determine the binding on and off rates of heteromultimeric polypeptide against a tumor cell marker. BlAcore kinetic analysis comprises analyzing the binding and - 43 dissociation of antibodies from chips with immobilized tumor cell marker antigens on their surface. [00157] In another aspect of the invention, the antibodies can be chemically or biosynthetically linked to anti-tumor agents or detectable signal-producing agents. Anti tumor agents linked to an antibody include any agents that destroy or damage a tumor to which the antibody has bound or in the environment of the cell to which the antibody has bound. For example, an anti-tumor agent is a toxic agent such as a chemotherapeutic agent or a radioisotope. Suitable chemotherapeutic agents are known to those skilled in the art and include anthracyclines (e.g. daunomycin and doxorubicin), methotrexate, vindesine, neocarzinostatin, cis-platinum, chlorambucil, cytosine arabinoside, 5 fluorouridine, melphalan, ricin and calicheamicin. The chemotherapeutic agents are conjugated to the antibody using conventional methods (See, e.g., Hermentin and Seiler (1988) Behring Inst. Mitt. 82, 197-215). [001581 Detectable signal-producing agents are useful in vivo and in vitro for diagnostic purposes. The signal producing agent produces a measurable signal which is detectible by external means, usually the measurement of electromagnetic radiation. For the most part, the signal producing agent is an enzyme or chromophore, or emits light by fluorescence, phosphorescence or chemiluminescence. Chromophores include dyes that absorb light in the ultraviolet or visible, region, and can be substrates or degradation products of enzyme catalyzed reactions. [001591 The invention further contemplates heteromultimeric polypeptides to which target or reporter moieties are linked. Target moieties are first members of binding pairs. Anti tumor agents, for example, are conjugated to second members of such pairs and are thereby directed to the site where the antibody is bound. A common example of such a binding pair is avidin and biotin. In one embodiment, biotin is conjugated to a heteromultimeric polypeptide of the invention, and thereby provides a target for an anti tumor agent or other moiety that is conjugated to avidin or streptavidin. Alternatively, biotin or another such moiety is linked to a heteromultimeric polypeptide of the invention and used as a reporter, for example in a diagnostic system where a detectable signal producing agent is conjugated to avidin or streptavidin. [001601 The heteromultimeric polypeptides can be administered for therapeutic treatments to a patient suffering from a tumor in an amount sufficient to prevent or reduce the - 44 progression of the tumor, e.g, the growth, invasiveness, metastases and/or recurrence of the tumor. An amount adequate to accomplish this is defined as a therapeutically effective dose. Amounts effective for this use will depend upon the severity of the disease and the general state of the patient's own immune system. Dosing schedules will also vary with the disease state and status of the patient, and will typically range from a single bolus dosage or continuous infusion to multiple administrations per day (e.g., every 4-6 hours), or as indicated by the treating physician and the patient's condition. Antibodies of the invention can be administered in a single dosages as high as 40 mg/kg body-weight or higher. More preferably, the antibodies are administered in dosages that range from 0.2 mg/kg to 20 mg/kg body-weight. It should be noted, however, that the present invention is not limited to any particular dose. 1001611 The present invention can be used to treat any suitable tumor, including, for example, tumors of the breast, heart, lung, small intestine, colon, spleen, kidney, bladder, head and neck, ovary, prostate, brain, pancreas, skin, bone, bone marrow, blood, thymus, uterus, testicles, cervix or liver. [001621 Formulations are prepared for storage and use by combining a purified heteromultimeric polypeptide of the present invention with a pharmaceutically acceptable vehicle (e.g. carrier, excipient) (Remington, The Science and Practice of Pharmacy 20th Edition Mack Publishing, 2000). Suitable pharmaceutically acceptable vehicles include, but are not limited to, nontoxic buffers such as phosphate, citrate, and other organic acids; salts such as sodium chloride; antioxidants including ascorbic acid and methionine; preservatives (e.g. octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride; benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens, such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3 pentanol; and m-cresol); low molecular weight polypeptides (e.g. less than about 10 amino acid residues); proteins such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, histidine, arginine, or lysine; carbohydrates such as monosacchandes, disaccharides, glucose, mannose, or dextrins; chelating agents such as EDTA; sugars such as sucrose, mannitol, trehalose or sorbitol; salt-forming counter-ions such as sodium; metal complexes (e.g. Zn-protein complexes); and non-ionic surfactants such as TWEEN or polyethylene glycol (PEG).
    - 45 [001631 The pharmaceutical composition of the present invention can be administered in any number of ways for either local or systemic treatment. Administration can be topical (such as to mucous membranes including vaginal and rectal delivery) such as transdermal patches, ointments, lotions, creams, gels, drops, suppositories, sprays, liquids and powders; pulmonary (e.g., by inhalation or insufflation of powders or aerosols, including by nebulizer; intratracheal, intranasal, epidermal and transdermal); oral; or parenteral including intravenous, intraarterial, subcutaneous, intraperitoneal or intramuscular injection or infusion; or intracranial (e.g., intrathecal or intraventricular) administration. [001641 The therapeutic formulation can be in unit dosage form. Such formulations include tablets, pills, capsules, powders, granules, solutions or suspensions in water or non-aqueous media, or suppositories for oral, parenteral, or rectal administration or for administration by inhalation. In solid compositions such as tablets the principal active ingredient is mixed with a pharmaceutical carrier. Conventional tableting ingredients include corn starch, lactose, sucrose, sorbitol, talc, stearic acid, magnesium stearate, dicalcium phosphate or gums, and other diluents (e.g. water) to form a solid preformulation composition containing a homogeneous mixture of a compound of the present invention, or a non-toxic pharmaceutically acceptable salt thereof The solid preformulation composition is then subdivided into unit dosage forms of the type described above. The tablets, pills, etc of the novel composition can be coated or otherwise compounded to provide a dosage form affording the advantage of prolonged action. For example, the tablet or pill can comprise an inner composition covered by an outer component. Furthermore, the two components can be separated by an enteric layer that serves to resist disintegration and permits the inner component to pass intact through the stomach or to be delayed in release. A variety of materials can be used for such enteric layers or coatings, such materials including a number of polymeric acids and mixtures of polymeric acids with such materials as shellac, cetyl alcohol and cellulose acetate. [001651 Pharmaceutical formulations include heteromultimeric polypeptides of the present invention complexed with liposomes (Epstein, et al., 1985, Proc. Nati. Acad. Sci. USA 82:3688; Hwang, et al., 1980, Proc. Natl. Acad. Sci. USA 77:4030; and U.S. Patent 4,485,045 and 4,544,545). Liposomes with enhanced circulation time are disclosed in U.S. Patent 5,013,556. Some liposomes can be generated by the reverse phase -46 evaporation with a lipid composition comprising phosphatidylcholine, cholesterol, and PEG-derivatized phosphatidylethanolamine (PEG-PE). Liposomes are extruded through filters of defined pore size to yield liposomes with the desired diameter. [001661 The heteromultimeric polypeptides can also be entrapped in microcapsules. Such microcapsules are prepared, for example, by coacervation techniques or by interfacial polymerization, for example, hydroxymethylcellulose or gelatin-microcapsules and poly (methylmethacylate) microcapsules, respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules) or in macroemulsions as described in Remington, The Science and Practice of Pharmacy 20th Ed. Mack Publishing (2000). [001671 In addition sustained-release preparations can be prepared. Suitable examples of sustained-release preparations include semipermeable matrices of solid hydrophobic polymers containing the antibody, which matrices are in the form of shaped articles (e.g. films, or microcapsules). Examples of sustained-release matrices include polyesters, hydrogels such as poly(2-hydroxyethyl-methacrylate) or poly(v nylalcohol), polylactides (U.S. Patent 3,773,919), copolymers of L-glutamic acid and 7 ethyl-L-glutamate, non degradable ethylene-vinyl acetate, degradable lactic acid-glycolic acid copolymers such as the LUPRON DEPOT TM (injectable microspheres composed of lactic acid-glycolic acid copolymer and leuprolide acetate), sucrose acetate isobutyrate, and poly-D-(-)-3 hydroxybutyric acid. [001681 In some embodiments, the treatment involves the combined administration of a heteromultimeric polypeptides of the present invention and a chemotherapeutic agent or cocktail of multiple different chemotherapeutic agents. Treatment with a heteromultimeric polypeptides can occur prior to, concurrently with, or subsequent to administration of chemotherapies. Chemotherapies contemplated by the invention include chemical substances or drugs that are known in the art and are commercially available, such as Doxorubicin, 5-Fluorouracil, Cytosine arabinoside ("Ara-C"), Cyclophosphamide, Thiotepa, Busulfan, Cytoxin, Taxol, Methotrexate, Cisplatin, Melphalan, Vinblastine, Gemcitabine, Irinotecan, and Carboplatin. Combined administration can include co-administration, either in a single pharmaceutical formulation or using separate formulations, or consecutive administration in either order but generally within a time period such that all active agents can exert their biological - 47 activities simultaneously. Preparation and dosing schedules for such chemotherapeutic agents can be used according to manufacturers' instructions or as determined empirically by the skilled practitioner. Preparation and dosing schedules for such chemotherapy are also described in Chemotherapy Service Ed., M. C. Perry, Williams & Wilkins, Baltimore, Md. (1992). [001691 In other embodiments, the treatment involves the combined administration of a heteromultimeric polypeptide of the present invention and radiation therapy. Treatment with heteromultimeric polypeptide can occur prior to, concurrently with, or subsequent to administration of radiation therapy. Any dosing schedules for such radiation therapy can be used as determined by the skilled practitioner. [001701 In other embodiments, the treatment can involve the combined administration of heteromultimeric polypeptides of the present invention with antibodies against tumor associated antigens including, but not limited to, antibodies that bind to the EGF receptor (EGFR) (cetuximab/Erbitux*), the erbB2 receptor (HER2) (trastuzumab/Herceptin*), and vascular endothelial growth factor (VEGF) (bevacizumab/Avastin*). Furthermore, treatment can include administration of one or more cytokines, can be accompanied by surgical removal of cancer cells or any other therapy deemed necessary by a treating physician. [00171] In other embodiments, the treatment can involve the combined administration of heteromultimeric polypeptides of the present invention and a second therapeutic. In some embodiments, the second therapeutic is administered to treat a side effect caused by administration of the heteromultimeric polypeptide. 1001721 For the treatment of the disease, the appropriate dosage of a heteromultimeric polypeptide of the present invention depends on the type of disease to be treated, the severity and course of the disease, the responsiveness of the disease, whether the heteromultimeric polypeptide is administered for therapeutic or preventative purposes, previous therapy, patient's clinical history, and so on all at the discretion of the treating physician. The heteromultimeric polypeptide can be administered one time or over a series of treatments lasting from several days to several months, or until a cure is effected or a diminution of the disease state is achieved (e.g. reduction in tumor size). Optimal dosing schedules can be calculated from measurements of drug accumulation in the body of the patient and will vary depending on the relative potency of an individual antibody.
    -48 The administering physician can easily determine optimum dosages, dosing methodologies and repetition rates. In general, dosage is from 0.01 ig to 100 mg per kg of body weight, and can be given once or more daily, weekly, monthly or yearly. The treating physician can estimate repetition rates for dosing based on measured residence times and concentrations of the drug in bodily fluids or tissues. [001731 The present invention provides kits comprising the heteromultimeric polypeptides described herein and that can be used to perform the methods described herein. In certain embodiments, a kit comprises at least one purified heteromultimeric polypeptide against a tumor marker in one or more containers. In certain embodiments, a kit comprises at least two heteromultimeric polypeptides. One skilled in the art will readily recognize that the disclosed antibodies of the present invention can be readily incorporated into one of the established kit formats that are well known in the art. [001741 Embodiments of the present disclosure can be further defined by reference to the following examples that describe in detail preparation of heteromultimeric polypeptides of the present disclosure and methods for using heteromultimeric polypeptides of the present disclosure. It will be apparent to those skilled in the art that many modifications, both to materials and methods, can be practiced without departing from the scope of the present disclosure. Wherever possible, the same reference numbers will be used throughout the drawings to refer to the same or like parts. As used herein and in the appended claims, the singular forms "a," "or," and "the" include plural referents unless the context clearly dictates otherwise. Thus, for example, reference to "an antibody" includes a plurality of such antibodies or one or more antibodies and equivalents thereof known to those skilled in the art. Furthermore, all numbers expressing quantities of ingredients, reaction conditions, purity, polypeptide and polynucleotide lengths, and so forth, used in the specification, are modified by the term "about," unless otherwise indicated. Accordingly, the numerical parameters set forth in the specification and claims are approximations that can vary depending upon the desired properties of the present invention. [00175] All of the various embodiments or options described herein can be combined in any and all variations.
    - 49 EXAMPLES Example 1. Identification of candidate interactions within the antibody dimerization interface. [001761 In order to better understand the nature of the dimerization interface between antibody heavy chain CH3 domains, the crystal structure of an antibody CH3 domain (structure first reported by Deisenhofer. J. (1981) Biochemistry, 20, 2361-2370) was examined. In this structure, the dimerization of the two Fc fragments is mediated by inter-chain interactions between CH3 domains (Figure 1). The CH3 domain interaction surface contains a central region of hydrophobic residues flanked by residues of both hydrophilic or charged character. Within the core hydrophobic region there are conserved tyrosines which present hydroxyl groups for potential hydrophilic interactions, thus serving both as hydrophobic residues and also serving to enable hydrophilic interactions. Figure 2 shows depictions of the structure of the dimerized CH3 domain. One strand is shaded darker than the other for clarity. The side chains of the amino acids which line the interaction surface between CH3 domains are shown. Figure 3 highlights select amino acids within the CH3 domain involved in potential inter-chain interactions in three separate views of the structure. The amino acid position numbers in Figure 3 are relative to the constant region of human IgG2. Figure 4 shows an alignment of the constant domains of the human IgG isotypes. The particular residues that can participate in inter-chain interactions and that are noted in Figure 2 are highlighted. Table 1 lists the amino acid position corresponding to these residues that are potentially involved in inter chain interactions for each of the human IgG isotypes with numbering nomenclature relative to the human IgG germline constant domains. Table 1 Amino Acid Human Human Human Human IgG1 IgG2 IgG3 IgG4 Residue # Residue # Residue # Residue # Tyr 232 228 279 229 Leu 234 230 281 231 Ser 237 233 284 234 Glu or Asp 239 235 286 236 -50 Glu 240 236 287 237 Lys 243 239 290 240 Gln 245 241 292 242 Ser 247 243 294 244 Thr 249 245 296 246 Leu 251 247 298 248 Lys 253 249 300 250 Asn 273 269 320 270 Lys or Asn 275 271 322 272 Thr 277 273 324 274 Val or Met 280 276 327 277 Asp 282 278 329 279 Asp 284 280 331 281 Ser 286 282 333 283 Phe 288 284 335 285 Tyr 290 286 337 287 Lys or Arg 292 288 339 289 Thr 294 290 341 291 Example 2: Identification of Fe variants that selectively heterodimerize [001771 The ability of several types of modifications in the CH3 domain of an antibody was analyzed for their ability to generate spontaneously heterodimeric antibodies. It was reasoned that by selectively reducing hydrophilic interactions that occur between each CH3 strand it might be possible to make antibody homodimerization less favorable, and that by simultaneously introducing substitutions that render homodimerization unfavorable, but heterodimerization permissible, it might be possible to generate pairs of compatible Fe variants that selectively heterodimerize, but have very little propensity to homodimerize. [00178] Therefore, a series of variant pairs were created and assessed for their ability to selectively form heterodimeric antibody. Amino acid substitutions were introduced into either a truncated heavy chain (termed mini-body) containing the linker and CH2-CH3 region of a heavy chain, or a full length antibody heavy chain heavy chain. The use of two different sized heavy chains enabled the visualization of the heterodimer species as a molecule of intermediate molecular mass and provided an assay for assessment of the -51 relative propensity of variant antibodies to form heterodimer. This assay format is depicted in cartoon form in Figure 5. Several variants pairs of antibodies were tested. Amino acid substitutions were introduced into antibody expression vectors that varied the identity of selected amino acids that have the potential to participate in inter-chain interactions. Expression vectors encoding these variant antibody sequences were then transfected alone or in combination with other partner chains into mammalian cells (human HEK 293 cells). After 48 hours, conditioned media from the transfected cells was collected and subjected to western blot analysis and probed with an antibody directed towards the human Fc domain. [001791 As shown in Figure 6, pairs of variants in which each variant possessed little, if any, propensity for homodimerization were designed, but when co-expressed were able to efficiently contribute to heterodimer formation. Co-expression of antibody variant Var2 (containing amino acid substitutions 249 K to E; 286 Y to F; and 288 K to E) with antibody variant Var3 (13A) (containing amino acid substitutions 236 E to K; 278 D to K) results in almost exclusive formation of heterodimer. The simultaneous combination of both the alteration of charged amino acids to manipulate attractive and repulsive forces to favor heterodimerization and the alteration of amino acid interactions within the "core" of the antibody dimerization interface, here accomplished by the elimination of the hydroxyl interactions mediated by the central tyrosine through its replacement by the non polar phenylalanine amino acid residue, to reduce homodimerization propensity. This combination of manipulations enables both the effective reduction of homodimerization and the retention of heterodimerization. Example 3: Binding of Bispecific Antibody to Two Different Targets [00180] Enyzme-linked immunosorbent assay (ELISA) was conducted to examine the ability of bispecific antibody variant (Var2-Var3) to bind to antigens. ELISA plates were coated with either no antigen (-), anti-FLAG antibody (0.05 mg/ml, clone M2 from SIGMA), or recombinant human delta-like ligand 4 (DLL4) (0.1 mg/ml) (amino acids 27 519 with a carboxy-terminal 8xHis tag). Coated plates were then incubated with control cell culture medium (negative control) or conditioned medium from cells transfected with expression vectors encoding Var2, Var3 and light chain L2 as indicated. After allowing binding to occur for 1 hour at room temperature, the plates were washed and bound - 52 antibody was detected by use of HRP-conjugated anti-human IgG secondary antibody. The bispecific antibody variant produced by co-expression of variants Var2 and Var3 possesses functional activity (Figure 7). The Var3 (13A) heavy chain and paired light chain are able to bind to DLL4, the antigen recognized by the parent homodimeric antibody utilized to develop Var3, and the Var2 heavy chain arm displays a FLAG epitope tag and is able to interact with anti-FLAG antibody cy ELISA. Thus, the bispecific antibody is able to interact with two different targets, with each heavy chain being involved in a distinct interaction. Example 4: Development of anti-VEGF antibodies [001811 Mice were immunized with human VEGF and the spleens isolated. The heavy chains were PCR amplified and inserted into a phagemid library of human light chain kappa genes. The phagemid library was rescued and selected against human VEGF for three successive rounds. A panel of VEGF (+) Fabs were isolated and tested in a series of assays to find VEGF antagonists (HUVEC proliferation assay, Biacore blocking assay). [001821 In a HUVEC proliferation assay, one VEGF (+) Fab (219R0302) partially inhibited VEGF-induced HUVEC proliferation (Figure 8). Briefly, frozen HUVEC cells (Lonza CC-2517) were passaged in ECGM (Lonza CC-3124) and mini-banked. Cells were directly thawed from mini-banked HUVEC in growth media, M199+10% Heat inactivated FBS (Gibco Cat#10082139)+50 ptg/ml of EGS (BD:354006)+1X Heparin +1mM L-Gln. To conduct a proliferation assay, a 96 well plate (Greiner Bio-One Cat#655098) was precoated with 50 pl of 10 ptg/ml of Rat Tail Collegen Type I solution (BD: 354236, collegen I was made in 0.02N Acetic Acid) at 4'C overnight. The next day, the plate was thoroughly aspirated to remove collegen I solution and washed once with 200 ptl DPBS. The HUVEC cells were trypsinized off the flask using endothelial cell sub-clone reagent (Lonza: CC-5034). All cells were collected from the flask and isolated via centrifugation at 1200 rpm for 5 minutes at 4'C. The cells were resuspended in starvation/assay media (M199+2% H. I.FBS+1XHeparine+1mM L+5 units/ml Heparin Gln) at a density 105 cells/ml. The cells were seeded into the assay plate at 5000/well, 50 pl/well. The cells were then allowed to rest for 3 hours in a 37'C incubator. The cells were washed carefully once with DPBS by drop-wise adding DPBS 200 ptl, and then 100 [l of starvation media was added. Cells were allowed to incubate at 37'C overnight. The next morning (assay d=0), the testing antibodies (or control: Avastin and LZ1) were - 53 prepared in combination with rhVEGF (R&D 293-VE-010). In cases where a a titration of different antibody concentrations were tested, 5-fold dilutions (starting from 20 ptg/ml of final concentration) were prepared in combination with rhVEGF (5 ng/pl of final concentration) in assay media. These solutions were preincubated at 37'C for 2 hours. The media from the assay plate was carefully aspirated and 100 tl of the Ab:VEGF mixes were added to the cells. After 3-4 day incubation in a 37'C incubator, additional Ab+rhVEGF mix (the same final concentration for Ab and rhVEGF were kept) was added to each well and allowed to incubate for another 4 days. On day 7, 20 tl of Alamar Blue reagent (InvitrogenCat#DAL1025) was added to 200 ptl culture and incubated at 37'C for 5 to 6 hours. The plate was read with a fluorescence microplate reader (Ex=530nm/Em=590nm). [00183] Fabs were also tested to see if they blocked VEGF-VEGFR2 interaction using the Biacore 2000. Briefly, VEGF was immobilized on a CM5 chip using standard amine based chemistry (NHS/EDC). Anti-VEGF Fabs or control Fab were flowed over the surface at 25 tg/ml and then immediately thereafter, recombinant VEGFR2 was flowed over the surface at 10 pg/ml. Upon further screening and sequencing, an additional light chain variant of this Fab (219R0202) was also discovered and shown to have similar properties (data not shown). The sequences for the 219R0302 and 219R0202 are shown as SEQ ID NOs: 10-16. The 219R0302 Fab completely blocked the binding of VEGFR2 to a VEGF in a Biacore blocking experiment (Figure 9). [001841 Both IgGs were reformatted to IgG2, expressed, and purified for confirmatory in vitro testing. Both 219R0202 and 219R0302 completely inhibited VEGF induced activation of HUVECS to nearly the same extent as bevacizumab (Avastin) (Figure 10), an approved anti-VEGF agent. [00185] IgG affinities were determined using a Biacore 2000 instrument. Briefly, recombinant proteins were immobilized on a CM5 chip using standard amine based chemistry (NHS/EDC). For each Fab and IgG, different concentrations (100 - 1 nM) were injected over the surface and kinetic data were collected over time. The data was fit using the simultaneous global fit equation to yield affinity constants (KD) for each Fab and IgG. 219R0202/219R0302 human and mouse VEGF affinities were determined and compared to Avastin. Unlike Avastin, 219R0202 and 219R0302 bind both human and - 54 mouse VEGF (Table 2). This data suggests that 219R0202/219R0302 epitope is not the same as Avastin, which only binds human VEGF. Table 2: 219R0302 and 219R0202 bind both human and mouse VEGF IgG hVEGF (nM) mVEGF (nM) 219R0302 2.1 21 219R0202 1.5 23 Avastin 1.3 NB [001861 Both antibodies were also tested in a breast tumor xenograft model (UM-PE13) and exhibited significant inhibition of tumor growth (Figure 11). Briefly, UM-PE13, a breast tumor xenograft lines, was established at the University of Michigan. Immunocompromised male NOD/SCID mice were used for the establishment of UM PE13 tumor xenografts. Mice were subcutaneously injected on the right flank with 300,000 viable cells. Once the tumor reached a size between 65 and 200 mm 3 , mice were randomized. As shown in Figure 11, 219R0302 induced stronger tumor-growth delay than 219R0202. Avastin showed the most potent growth-delay, which was indistinguishable from 219R0302, indicating that 219R0302 and Avastin have nearly equivalent potency in this model. Unlike 219R0302, 219R0202 was statistically different from both Avastin and 219R0302. Example 5: Development of bispecific antibody formats [001871 Using the discovered heterodimerization mutations (13A/13B, Figure 12A), two formats were used to generate a bispecific antibody targeting hDLL4 (21M18) and VEGF (21.9R0302, 219R0202). [001881 In the first format called Single Gene Bispecific (SGBSP), a 30 amino acid linker (5xGGGGS) linker was used to genetically tether the light chain to its heavy chain as done previously by Lee et al. (Mol. Immunol. 36:61-71 (1999)) (Figure 12B). In doing so, each binding unit uses its own light chain to form a Fab binding unit that binds its respective target. When coupled with the bispecific mutations (13A/13B) described above, two different single genes are brought together to form a bispecific antibody.
    - 55 [001891 In the second format called Monovalent Bispecific (MBSP), a common light chain was used in concert with two different heavy chains, one harboring the 13A mutation and the other harboring the 13B mutation (Figure 12C). For this approach, one or both of the heavy chains must be able to bind its target in combination with a common light chain. In some instances, the common light chain is the parental light chain for one of the heavy chains. [00190] Both antibody formats were constructed using 21M18 (anti-human DLL4) and 219R0302/219R0202 (anti-VEGF) as building blocks. The 21M18 and 219R0202/0302 heavy chains were cloned with the 13B and 13A Fe mutants, respectively. Once expressed and purified, each bispecific antibody was tested for anti-DLL4 and anti-VEGF activity compared to control antibody. [001911 To assess dual targeting in the Biacore, a high density VEGF surface was generated as described previously and the bispecific was flowed over at a high concentration to saturate the surface (25 ptg/ml). Immediately after bispecific binding to the surface, DLL4-Fc fusion protein was flowed over the same surface at 10 pig/ml. If both arms of the bispecific are functional, then DLL4 should bind to the unbound anti DLL4 arm of the bound bispecific. Example 6: Development of Anti-DLL4/Anti-VEGF Single Gene Bispecific (SGBSP) Antibody [00192] A SGBSP was created using 21M18 and either 219R0302 or 219R0202. Both SGBSPs expressed well and were purified by protein A chromatography. To assess the level of homo- vs. heterodimeric species, each SGBSP was assayed using isoelectric focusing. Since the homodimeric species (13A/13B homodimers) have different pI's from the heterodimeric species, the gel clearly shows that both SGBSPs were greater than 90% heterodimer based on gel densitometry (Figure 13A). [001931 To test their anti-VEGF activity, the antibodies were tested in the same VEGF induced proliferation assay. As shown in Figure 14, both 219R0302_21M18 and 219R0202_21M18 SGBSPs partially inhibited VEGF-induced HUVEC proliferation with the latter showing significantly better activity over the former. Since the VEGF binding unit is monomeric in the context of the bispecific, reduced activity is expected due to loss in avidity when compared to Avastin or the parental antibodies (219R0302/219R0202).
    -56 [001941 Both 219R0302_21M18 and 219R0202_21M18 SGBSPs were also assayed for their VEGF affinity. The 219R0202_21M18 SGBSP binding affinity was approximately 5-fold weaker (6.9 nM) than 219R0202 (1.5 nM), which consistent with a loss in avidity (Table 3). The 219R0302_21M18 SGBSP binding affinity was approximately 4-fold weaker (7.6 nM) than 219R0302 (2.1 nM), which consistent with a loss in avidity (Table 3). Table 3: SGBSP and MBSP VEGF Biacore Analysis. IgG VEGF (nM) 219R0302 2.1 219R0202 1.5 219R0302_21M18 SGBSP 7.6 219R0202_21M18 SGBSP 6.9 219R0202_21M18 MBSP 21 [00195] The 219R0202_21M18 SGBSP was also tested for binding to human DLL4 transfected cells in a FACS binding assay (Figure 15). When compared to 21M18, there was an approximately 5-fold loss in DLL4 binding activity due to the avidity loss. Briefly, Human 293 HEK cells were transfected using Fugene 6 transfection reagent as recommended by the manufacturer (Roche Inc.). Cells were transfected with cDNA expression vector encoding full length human DLL4, as well as a second vector encoding green fluorescent protein, pcDNA-GFP, to mark the transiently transfected cells. Twenty-four to forty-eight hours post-transfection, cells were incubated with different SGBSP concentrations for 1 hour at 37'C. Cells were then rinsed twice with Staining Medium (HBSS with 2% FCS) and incubated with fluorescent secondary antibody, goat anti-human IgG H/L-phycoerythrin (PE), at 1:200 dilution in PBS for 1 hour. Cells were then analyzed by flow cytometry using a FACS Caliber instrument (BD Bioscience). Specific SBGSP binding was assessed by determining the presence of cells positive for GFP signal and PE signal. [00196] Using the dual targeting assay described above, both 219R0302_21M18 and 219R0202_21M18 SGBSPs displayed binding to both VEGF and DLL4 as expected (Figure 16A). The SGBSP also displayed partial inhibition of VEGF-induced -57 proliferation (Figure 17). Thus, the assays confirm that the bispecific mutations were indeed bringing together each binding unit in a heterodimeric manner and that each binding arm is functional. Example 7: Development of Anti-DLL4/Anti-VEGF Monovalent Bispecific (MBSP) Antibody [001971 In the second example, a MBSP was created using 21M18 heavy chain, the common 219R0302/219R0202 heavy chain, and 21M18 light chain. The MBSP expressed well and was purified by protein A chromatography. To assess the level of homo- vs. heterodimeric species, the MBSP was assayed using isoelectric focusing. Since the homodimeric species (13A/13B homodimer) have different pI's from the heterodimeric one, IEF gel analysis showed the MBSP was greater than 90% heterodimer based on gel densitometry (Figure 13A). As shown in Figure 13B, the remaining 21M18 13B homodimer could be eliminated by increasing the ratio of 21R0202 heavy chain (13A) to 21M18 heavy chain (13B). [00198] Since the VEGF binding unit is monomeric and has lost its parental LC in the context of the bispecific, reduced binding activity is expected due to loss in avidity and light chain contribution to binding. As confirmation of this observation, MBSP binding affinity was approximately 14-fold weaker (21 nM) than 219R0202 (1.5 nM), which is consistent with the loss in avidity and light chain binding compared to the parental antibody (Table 3). [00199] The MBSP was also tested for binding to human DLL4 transfected cells in a FACS binding assay (Figure 15). When compared to 21M18, there was an approximately 3-fold loss in DLL4 binding activity due to the avidity loss. [002001 Using the dual targeting assay as described previously, the MBSP displayed binding to both VEGF and DLL4 as expected (Figure 16B). This assay confirmed that the bispecific mutations were indeed bringing together each binding unit in a heterodimeric manner and that each binding arm is functional.
    - 58 SEQUENCES Sequence Var 1 (13B) (SEQ ID NO: 1) (amino acid substitutions shown in bold) ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSL SSVVTVPSSNFGTQTYTCNVDHKPSNTKVDKTVERKCCVECPPCPAPPVAGPSVFLFPPKPKDTL MI SRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVVHQDWLNG KEYKCKVSNKGLPAPIEKTI SKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVEGFYPSDIAVEW ESNGQPENNYKTTPPMLDSDGSFFLYSELTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG K Sequence Var 1 (13B) - without CHI or hinge (SEQ ID NO:4) (amino acid substitutions shown in bold) PSVFLFPPKPKDTLMI SRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRV VSVLTVVHQDWLNGKEYKCKVSNKGLPAPIEKTI SKTKGQPREPQVYTLPPSREEMTKNQVSLTC LVEGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSELTVDKSRWQQGNVFSCSVMHEAL HNHYTQKSLSLSPGK Sequence Var 1 (13B) - CH3 only (SEQ ID NO:5) (amino acid substitutions shown in bold) KTKGQPREPQVYTLPPSREEMTKNQVSLTCLVEGFYPSDIAVEWESNGQPENNYKTTPPMLDSDG SFFLYSELTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK Sequence Var 2 (SEQ ID NO:2) ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSL SSVVTVPSSNFGTQTYTCNVDHKPSNTKVDKTVERKCCVECPPCPAPPVAGPSVFLFPPKPKDTL MI SRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVVHQDWLNG KEYKCKVSNKGLPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVEGFYPSDIAVEW ESNGQPENNYKTTPPMLDSDGSFFLFSELTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG K Sequence Var 2 - without CHI or hinge (SEQ ID NO:6) PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRV VSVLTVVHQDWLNGKEYKCKVSNKGLPAPIEKT ISKTKGQPREPQVYTLPPSREEMTKNQVSLTC LVEGFYPSDIAVEWESNGQPENNYKTTP PMLDSDGSFFLFSELTVDKSRWQQGNVFSCSVMHEAL
    HNHYTQKSLSLSPGK
    - 59 Sequence Var 2 - CH3 only (SEQ ID NO:7) KTKGQPREPQVYTLPPSREEMTKNQVSLTCLVEGFYPSDIAVEWESNGQPENNYKTTPPMLDSDG SFFLFSELTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK Sequence Var3 (13A) (SEQ ID NO:3) (amino acid substitutions shown in bold) ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSL SSVVTVPSSNFGTQTYTCNVDHKPSNTKVDKTVERKCCVECPPCPAPPVAGPSVFLFPPKPKDTL MISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVVHQDWLNG KEYKCKVSNKGLPAPIEKT ISKTKGQPREPQVYTLPPSREKMTKNQVSLTCLVKGFYPSDIAVEW ESNGQPENNYKTTPPMLKSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG K Sequence Var3 (13A) - without CHI or hinge (SEQ ID NO:8) (amino acid substitutions shown in bold) PSVFLFPPKPKDTLMI SRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRV VSVLTVVHQDWLNGKEYKCKVSNKGLPAPIEKTISKTKGQPREPQVYTLPPSREKMTKNQVSLTC LVKGFYPSDIAVEWESNGQPENNYKTTPPMLKSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEAL HNHYTQKSLSLS PGK Sequence Var3 (13A) - CH3 only (SEQ ID NO:9) (amino acid substitutions shown in bold) KTKGQPREPQVYTLPPSREKMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPMLKSDG SFFLYSKLTVDKSRWQQGNVFS CSVMHEALHNHYTQKSLSLS PGK 219R0302/0202 VH Amino Acid Sequence (SEQ ID NO:10) QVQLKQSGAELVKPGASVKLSCKASGYTFTNYWMHWVKLRPGQGFEWIGDINPSNGGTSYNEKFK RKATLTVDKSSSTAYMQLSSLTSEDSAVYYCTIHYYDNSYAMDYWGQGTSVTVSSAST 219R0302/0202 HC Amino Acid Sequence (SEQ ID NO:11) QVQLKQSGAELVKPGASVKLSCKASGYTFTNYWMHWVKLRPGQGFEWIGDINPSNGGTSYNEKFK RKATLTVDKSSSTAYMQLSSLTSEDSAVYYCTIHYYDNSYAMDYWGQGTSVTVSSASTKGPSVFP LAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSN FGTQTYTCNVDHKPSNTKVDKTVERKCCVECPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTC
    VVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVSNK
    -60 GLPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNY KTTPPMLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 219R0302/0202 HC DNA Sequence (SEQ ID NO:12) CAGGTGCAATTGAAGCAGTCTGGGGCTGAACTGGTGAAGCCTGGGGCTTCAGTGAAGTTGTCCTG CAAGGCTTCTGGCTACACCTTCACCAACTACTGGATGCACTGGGTGAAGCTGAGGCCTGGACAAG GCTTTGAGTGGATTGGAGATATTAATCCCAGCAATGGTGGTACTAGCTACAATGAGAAGTTCAAG AGAAAGGCCACACTGACTGTAGACAAATCCTCCAGCACAGCCTACATGCAACTCAGCAGCCTGAC ATCTGAGGACTCTGCGGTCTATTACTGTACAATACACTACTATGATAATTCCTATGCTATGGACT ACTGGGGTCAAGGAACCTCAGTCACCGTCAGCTCAGCCAGCACAAAGGGCCCTAGCGTCTTCCCT CTGGCTCCCTGCAGCAGGAGCACCAGCGAGAGCACAGCCGCCCTGGGCTGCCTGGTCAAGGACTA CTTCCCCGAACCGGTGACGGTGTCGTGGAACTCAGGCGCTCTGACCAGCGGCGTGCACACCTTCC CAGCTGTCCTACAGTCCTCAGGACTCTACTCCCTCAGCAGCGTGGTGACCGTGCCCTCCAGCAAC TTCGGCACCCAGACCTACACCTGCAACGTAGATCACAAGCCCAGCAACACCAAGGTGGACAAGAC AGTTGAGCGCAAATGTTGTGTCGAGTGCCCACCGTGCCCAGCACCACCTGTGGCAGGACCGTCAG TCTTCCTCTTCCCCCCAAAACCCAAGGACACCCTCATGATCTCCCGGACCCCTGAGGTCACGTGC GTGGTGGTGGACGTGAGCCACGAAGACCCCGAGGTCCAGTTCAACTGGTACGTGGACGGCGTGGA GGTGCATAATGCCAAGACAAAGCCACGGGAGGAGCAGTTCAACAGCACGTTCCGTGTGGTCAGCG TCCTCACCGTTGTGCACCAGGACTGGCTGAACGGCAAGGAGTACAAGTGCAAGGTCTCCAACAAA GGCCTCCCAGCCCCCATCGAGAAAACCATCTCCAAAACCAAAGGGCAGCCCCGAGAACCACAGGT GTACACCCTGCCCCCATCCCGGGAGGAGATGACCAAGAACCAGGTCAGCCTGACCTGCCTGGTCA AAGGCTTCTACCCCAGCGACATCGCCGTGGAGTGGGAGAGCAATGGGCAGCCGGAGAACAACTAC AAGACCACACCTCCCATGCTGGACTCCGACGGCTCCTTCTTCCTCTACAGCAAGCTCACCGTGGA CAAGAGCAGGTGGCAGCAGGGGAACGTCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAACC ACTACACGCAGAAGAGCCTCTCCCTGTCTCCGGGTAAA 219R0302 LC Amino Acid Sequence (SEQ ID NO:13) DIQMTQSPSSLSASVGDRVTITCQASQDI SNYVNWYQQKPGKAPKLLIYDASNLQTGVPSRFSGR GSGTHFTFTI SSLQPEDLATYYCQQYDDLPPTFGRGTKLEIKRTVAAPSVFIFPPSDEQLKSGTA SVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACE VTHQGLSSPVTKSFNRGEC 219R0302 LC DNA Sequence (SEQ ID NO:14) GATATCCAGATGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTCGGAGACAGAGTCACCATCAC TTGCCAGGCGAGTCAGGACATTAGCAACTATGTAAATTGGTATCAACAAAAACCAGGGAAAGCCC CTAAGCTCCTGATCTACGATGCATCCAACTTGCAAACAGGGGTCCCATCAAGGTTCAGTGGAAGG GGATCTGGGACACATTTTACTTTCACCATCAGCAGCCTGCAGCCTGAAGATCTGGCAACATATTA CTGTCAACAATATGATGATCTTCCTCCCACTTTTGGCAGAGGGACCAAGCTGGAGATCAAACGTA CGGTGGCTGCACCATCTGTCTTCATCTTCCCGCCATCTGATGAGCAGTTGAAATCTGGAACTGCC TCTGTTGTGTGCCTGCTGAATAACTTCTATCCCAGAGAGGCCAAAGTACAGTGGAAGGTGGATAA
    CGCCCTCCAATCGGGTAACTCCCAGGAGAGTGTCACAGAGCAGGACAGCAAGGACAGCACCTACA
    - 61 GCCTCAGCAGCACCCTGACGCTGAGCAAAGCAGACTACGAGAAACACAAAGTCTACGCCTGCGAA GTCACCCATCAGGGCCTGAGCTCGCCCGTCACAAAGAGCTTCAACAGGGGAGAGTGT 219R0202 LC Amino Acid Sequence (SEQ ID NO:15) DIQLTQSPSSLSASVGDRVTITCRASQGINNHLAWYQQKPGKVPKSLIYAASNLHSGVPSKFSGS GSGTHFTLI ISSLQPEDIATYYCQQYDNLPLTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTA SVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACE VTHQGLSSPVTKSFNRGEC 219R0202 LC DNA Sequence (SEQ ID NO:16) GATATCCAGTTGACCCAGTCTCCATCCTCACTGTCTGCATCTGTCGGAGACAGAGTCACCATCAC TTGTCGGGCGAGTCAGGGCATCAATAATCATTTAGCCTGGTATCAGCAGAAACCAGGGAAAGTCC CTAAGTCCCTCATATATGCTGCATCCAATCTCCATAGTGGCGTCCCATCAAAGTTCAGCGGCAGT GGATCTGGGACACACTTCACTCTCATCATCAGCAGCCTGCAGCCTGAAGATATTGCAACATATTA CTGTCAACAGTATGATAATCTCCCCCTCACTTTCGGCGGAGGGACCAAGGTGGAAATCAAACGTA CGGTGGCTGCACCATCTGTCTTCATCTTCCCGCCATCTGATGAGCAGTTGAAATCTGGAACTGCC TCTGTTGTGTGCCTGCTGAATAACTTCTATCCCAGAGAGGCCAAAGTACAGTGGAAGGTGGATAA CGCCCTCCAATCGGGTAACTCCCAGGAGAGTGTCACAGAGCAGGACAGCAAGGACAGCACCTACA GCCTCAGCAGCACCCTGACGCTGAGCAAAGCAGACTACGAGAAACACAAAGTCTACGCCTGCGAA GTCACCCATCAGGGCCTGAGCTCGCCCGTCACAAAGAGCTTCAACAGGGGAGAGTGT 219R0202SG (Var3/13A) Amino Acid Sequence (SEQ ID NO:17) (linker sequence is bold underlined) (1 3A substitutions shown in bold) DIQLTQSPSSLSASVGDRVTITCRASQGINNHLAWYQQKPGKVPKSLIYAASNLHSGVPSKFSGS GSGTHFTLI ISSLQPEDIATYYCQQYDNLPLTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTA SVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACE VTHQGLSSPVTKSFNRGECGGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSQVQLKQSGAELVKPG ASVKLSCKASGYTFTNYWMHWVKLRPGQGFEWIGDINPSNGGTSYNEKFKRKATLTVDKSSSTAY MQLSSLTSEDSAVYYCTIHYYDNSYAMDYWGQGTSVTVSSASTKGPSVFPLAPCSRSTSESTAAL GCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSNFGTQTYTCNVDHKPS NTKVDKTVERKCCVECPPCPAPPVAGPSVFLFPPKPKDTLMI SRTPEVTCVVVDVSHEDPEVQFN WYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKGLPAPIEKTISKTKG QPREPQVYTLPPSREKMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPMLKSDGSFFL YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 219R0302SG (Var3/13A) Amino Acid Sequence (SEQ ID NO:18) (linker sequence is bold underlined) (1 3A substitutions shown in bold) - 62 DIQMTQSPSSLSASVGDRVTITCQASQDISNYVNWYQQKPGKAPKLLIYDASNLQTGVPSRFSGR GSGTHFTFT ISSLQPEDLATYYCQQYDDLPPTFGRGTKLEIKRTVAAPSVFIFPPSDEQLKSGTA SVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACE VTHQGLSSPVTKSFNRGECGGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSQVQLKQSGAELVKPG ASVKLSCKASGYTFTNYWMHWVKLRPGQGFEWIGDINPSNGGTSYNEKFKRKATLTVDKSSSTAY MQLSSLTSEDSAVYYCTIHYYDNSYAMDYWGQGTSVTVSSASTKGPSVFPLAPCSRSTSESTAAL GCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSNFGTQTYTCNVDHKPS NTKVDKTVERKCCVECPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFN WYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKGLPAPIEKT ISKTKG QPREPQVYTLPPSREKMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPMLKSDGSFFL YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 21M18_SG (Varl/13B) Amino Acid Sequence (SEQ ID NO:19) (linker sequence is bold underlined) (13B substitutions shown in bold) DIVMTQSPDSLAVSLGERAT ISCRASESVDNYGI SFMKWFQQKPGQPPKLLIYAASNQGSGVPDR FSGSGSGTDFTLTI SSLQAEDVAVYYCQQSKEVPWTFGGGTKVEIKRTVAAPSVFIFPPSDEQLK SGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKV YACEVTHQGLSSPVTKSFNRGECGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSQVQLVQSGAEVK KPGASVKI SCKASGYSFTAYYIHWVKQAPGQGLEWIGYI SSYNGATNYNQKFKGRVTFTTDTSTS TAYMELRSLRSDDTAVYYCARDYDYDVGMDYWGQGTLVTVSSASTKGPSVFPLAPCSRSTSESTA ALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSNFGTQTYTCNVDHK PSNTKVDKTVERKCCVECPPCPAPPVAGPSVFLFPPKPKDTLMI SRTPEVTCVVVDVSHEDPEVQ FNWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKGLPAPIEKTI SKT KGQPREPQVYTLPPSREEMTKNQVSLTCLVEGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSF FLYSELTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 21R0302/0202 Heavy chain CDR1 (SEQ ID NO:20) GYTFTNYWMH 219R0302/0202 Heavy chain CDR2 (SEQ ID NO:21) SINPSNGGTSYNEKFKR 219R0302/0202 Heavy chain CDR3 (SEQ ID NO:22) HYYDNSYAMDY 219R0302 Light chain CDR1 (SEQ ID NO:23) - 63 QASQDISNYVN 219R0302 Light chain CDR2 (SEQ ID NO:24) DASNLQT 219R0302 Light chain CDR3 (SEQ ID NO:25) QQYDDLPP 219R0202 Light chain CDR1 (SEQ ID NO:26) RASQGINNHLAW 219R0202 Light chain CDR2 (SEQ ID NO:27) AASNLHS 219R0202 Light chain CDR3 (SEQ ID NO:28) QQYDNL PL 219R0302 VL Amino Acid Sequence (SEQ ID NO:29) DIQMTQSPSSLSASVGDRVTITCQASQDISNYVNWYQQKPGKAPKLLIYDASNLQTGVPSRFSGR GSGTHFTFTISSLQPEDLATYYCQQYDDLPPTFGRGTKLEIKRT 219R0202 VL Amino Acid Sequence (SEQ ID NO:30) DIQLTQSPSSLSASVGDRVTITCRASQGINNHLAWYQQKPGKVPKSLIYAASNLHSGVPSKFSGS GSGTHFTL I ISSLQPEDIATYYCQQYDNLPLTFGGGTKVEIKRT
    权利要求:
    Claims (110)
    [1] 1. A method of preparing a heteromultimeric polypeptide comprising two human immunoglobulin CH3 domain-containing polypeptides, the method comprising substituting at least one amino acid within the CH3 domain of one of the polypeptides at a position corresponding to a position selected from the group consisting of positions 236, 245, 249, 278, 286, and 288 of human IgG2 with another amino acid, thereby promoting heteromultimer formation.
    [2] 2 A method of preparing a heteromultimeric polypeptide comprising two human immunoglobulin CH3 domain-containing polypeptides, the method comprising substituting at least one charged amino acid residue in the CH3 domain of each of the polypeptides with an amino acid of the opposite charge.
    [3] 3 The method of claim 2, wherein the pair of substituted amino acids form an ion pair in the heteromultimeric polypeptide.
    [4] 4. A method of preparing a heteromultimeric polypeptide comprising two human immunoglobulin CH3 domain-containing polypeptides, the method comprising substituting at least one hydrophilic amino acid residue in the CH3 domain of one of the polypeptides with another amino acid.
    [5] 5. The method of claim 4, wherein the hydrophilic amino acid residue is substituted by a hydrophobic residue.
    [6] 6. The method of claim 4, wherein an amino acid having a hydroxyl side chain is substituted with an amino acid that does not have a hydroxyl side chain.
    [7] 7. The method of claims 1 or 2, wherein the method further comprises substituting at least one hydrophilic amino acid residue in the CH3 domain of one of the polypeptides with another amino acid at the interface of the two polypeptides in one of the polypeptides with another amino acid.
    [8] 8. The method of any of claims 1-7, wherein the substituted amino acid interacts with another amino acid at the interface of the two polypeptides. - 65
    [9] 9. The method of any of claims 1-8, wherein the amino acid that is substituted is listed in Table 1, or is an amino acid at a position corresponding to those listed in Table 1.
    [10] 10. The method of any of claims 1-9, wherein the human immunoglobulin CH3 domain of both polypeptides is selected from the group consisting of IgG, IgA, and IgD CH3 domains.
    [11] 11. The method of claim 10, wherein the immunoglobulin CH3 domain is an IgG2 CH3 domain.
    [12] 12. The method of any of claims 1-11, wherein the first CH3-domain containing polypeptide comprises a first immunoglobulin heavy chain polypeptide that specifically binds to a first immunoglobulin light chain polypeptide, and the second C113-domain containing polypeptide comprises a second immunoglobulin heavy chain polypeptide that specifically binds to a second immunoglobulin light chain polypeptide.
    [13] 13. The method of claim 12, wherein the first immunoglobulin light chain polypeptide and the second immunoglobulin light chain polypeptide are identical in amino acid sequence.
    [14] 14. The method of claim 12, wherein the immunoglobulin light chain polypeptide is linked to the immunoglobulin heavy chain polypeptide.
    [15] 15. The method of any of claims 1-14, which comprises substituting amino acids in one CH3 domain at positions corresponding to position 249 and position 288 of human IgG2.
    [16] 16. The method of claim 15, wherein the amino acids at positions 249 and 288 are replaced with glutamate.
    [17] 17. The method of claim 15, wherein the amino acids at positions 249 and 288 are replaced with aspartate.
    [18] 18. The method of any of claims 1-14, which comprises substituting amino acids in one CH3 domain at positions corresponding to position 249, position 286, and position 288 of human IgG2.
    [19] 19. The method of claim 18, wherein the amino acids at positions 249 and 288 are replaced with glutamate, and the amino acid at position 286 is replaced with phenylalanine. - 66
    [20] 20. The method of any of claims 13-19, which further comprises substituting amino acids in the second CH3 domain at positions corresponding to position 236 and position 278 of human IgG2.
    [21] 21. The method of claim 20, wherein the amino acid at position 236 is replaced with a lysine, and the amino acid at position 278 is replaced with a lysine.
    [22] 22. The method of any of claims 1-14, which comprises substituting amino acids in one CH3 domain at positions corresponding to position 236 and position 278 of human IgG2.
    [23] 23. The method of claim 22, wherein the amino acid at position 236 is replaced with a lysine, and the amino acid at position 278 is replaced with a lysine.
    [24] 24. The method of any of claims 1-23, wherein the heteromultimeric polypeptide is monovalent.
    [25] 25. The method of claim 24, wherein the monovalent heteromultimeric polypeptide comprises a detectable label or epitope.
    [26] 26. The method of any of claims 1-23, wherein the heteromultimeric polypeptide is bivalent.
    [27] 27. The method of any of claims 1-23 or 26, wherein the first polypeptide binds a target molecule through its immunoglobulin antigen binding domain, and the second polypeptide is an immunoadhesin.
    [28] 28. The method of any of claims 1-27, wherein the first and second polypeptides preferentially assemble with each other as heterodimers, relative to assembly of homodimers.
    [29] 29. The method of any of claims 1-23 and 26-28, wherein the first and second polypeptides assemble to form a bispecific antibody.
    [30] 30. The method of claim 29, wherein the bispecific antibody specifically binds two different antigens.
    [31] 31. The method of claim 29, wherein the bispecific antibody binds two different epitopes on the same antigen. - 67
    [32] 32. The method of any of claims 1-31, wherein the heteromultimeric polypeptide specifically binds an antigen selected from the group consisting of: DLL4, VEGF, VEGFR2, Notchl, Notch2, Notch3, Notch4, Notch(pan), JAGI, JAG2, DLL(pan), JAG(pan), EGFR, ERBB2, ERBB3, ERBB(pan), c-Met, IGF-1R, PDGFR, Patched, Hedgehog family polypeptides, Hedgehog(pan), WNT family polypeptides, WNT(pan), FZDl, FZD2, FZD3, FZD4, FZD5, FZD6, FZD7, FZD8, FZD9, FZDIO, FZD(pan), LRP5, LRP6, CD20, IL-6, TNFalpha, IL-23, IL 17, CD80, CD86, CD3, CEA, Mucl6, PSMA, PSCA, CD44, c-Kit, DDR1, DDR2, RSPO1, RSPO2, RSPO3, RSPO4, RSPO(pan), BMP family polypeptides, BMP (pan), BMPR1a, BMPR1b, and a combination thereof.
    [33] 33. The method of claim 30, wherein the heteromultimeric polypeptide is a bispecific antibody that specifically binds to DLL4 and VEGF.
    [34] 34. The method of claim 32, wherein the heteromultimeric polypeptide specifically binds VEGF and comprises SEQ ID NO:17 or SEQ ID NO:18.
    [35] 35. The method of claim 32, wherein the heteromultimeric polypeptide specifically binds DLL4 and comprises the SEQ ID NO:19.
    [36] 36. The method of claim 33, wherein the light chain polypeptides are identical in amino acid sequence.
    [37] 37. The method of claim 33, wherein the light chain polypeptides are linked to the heavy chain polypeptides.
    [38] 38. The method of any of claims 30-33, which comprises substituting amino acids in one CH3 domain at positions corresponding to position 249 and position 288 of human IgG2.
    [39] 39. The method of claim 38, wherein the amino acids at positions 249 and 288 are replaced with glutamate.
    [40] 40. The method of claim 38, wherein the amino acids at positions 249 and 288 are replaced with aspartate. - 68
    [41] 41. The method of any of claims 33-40, which further comprises substituting amino acids in the second CH3 domain at positions corresponding to position 236 and position 278 of human IgG2.
    [42] 42. The method of claim 41, wherein the amino acid at position 236 is replaced with a lysine, and the amino acid at position 278 is replaced with a lysine.
    [43] 43. The method of any of claims 33-42, which comprises substituting amino acids in one CH3 domain at positions corresponding to position 236 and position 278 of human IgG2.
    [44] 44. The method of claim 43, wherein the amino acid at position 236 is replaced with a lysine, and the amino acid at position 278 is replaced with a lysine.
    [45] 45. The method of claim 33, wherein heteromultimeric polypeptide comprises a VEGF binding sequence comprising the heavy chain sequence of SEQ ID NO: 11 and the light chain sequence of SEQ ID NO:13 or SEQ ID NO:15.
    [46] 46. The method of claim 45, wherein the light chain is linked to the heavy chain.
    [47] 47. The method of claim 33, wherein the heteromultimeric polypeptide comprises a DLL4 binding sequence comprising SEQ ID NO: 19.
    [48] 48. The method of any of claims 45-47, wherein the heteromultimeric polypeptide comprises a VEGF binding sequence comprising the heavy chain sequence of SEQ ID NO: 11 and the light chain sequence of SEQ ID NO:13 or SEQ ID NO:15; and a DLL4 binding sequence comprising SEQ ID NO:19.
    [49] 49. An antibody that specifically binds VEGF, wherein the antibody comprises: (a) a heavy chain CDR1 comprising GYTFTNYWMH (SEQ ID NO:20), a heavy chain CDR2 comprising SINPSNGGTSYNEKFKR (SEQ ID NO:21), and a heavy chain CDR3 comprising HYYDNSYAMDY (SEQ ID NO:22); and/or (b) a light chain CDR1 comprising QASQDISNYVN (SEQ ID NO:23), a light chain CDR2 comprising DASNLQT (SEQ ID NO:24), and a light chain CDR3 comprising QQYDDLPP (SEQ ID NO:25). - 69
    [50] 50. An antibody that specifically binds VEGF, wherein the antibody comprises: (a) a heavy chain CDR1 comprising GYTFTNYWMH (SEQ ID NO:20), a heavy chain CDR2 comprising SINPSNGGTSYNEKFKR (SEQ ID NO:21), and a heavy chain CDR3 comprising HYYDNSYAMDY (SEQ ID NO:22); and/or (b) a light chain CDR1 comprising RASQGINNHLAW (SEQ ID NO:26), a light chain CDR2 comprising AASNLHS (SEQ ID NO:27), and a light chain CDR3 comprising QQYDNLPL (SEQ ID NO:28).
    [51] 51. The antibody of claim 49 or 50, which is an antagonist of human VEGF.
    [52] 52. The antibody of claim 49 or 50, which is an antibody fragment.
    [53] 53. The antibody of claim 49 or 50, which is a monoclonal antibody.
    [54] 54. The antibody of claim 49 or 50, which is a humanized antibody.
    [55] 55. The antibody of claim 49 or 50, which inhibits tumor growth.
    [56] 56. The antibody of any of claims 49-56, which binds to human VEGF with a KD of about 100 nM or less.
    [57] 57. A heteromultimeric polypeptide prepared by the method of any of claims 1-48.
    [58] 58. A heteromultimeric polypeptide having the characteristics of a heteromultimeric polypeptide prepared by the method of any one of claims 1-48.
    [59] 59. The heteromultimeric polypeptide of claim 57 or claim 58 which is monovalent.
    [60] 60. The heteromultimeric polypeptide of claim 57 or claim 58 which is bivalent.
    [61] 61. The heteromultimeric polypeptide of any of claims 57, 58, or 60, wherein the polypeptide is a bispecific antibody. -70
    [62] 62. A polypeptide comprising an immunoglobulin CH3 domain, wherein the CH3 domain contains a glutamate at positions corresponding to positions 249 and 288 of human IgG2.
    [63] 63. A polypeptide comprising an immunoglobulin CH3 domain, wherein the CH3 domain contains a glutamate at positions corresponding to positions 249 and 288 of human IgG2 and a phenylalanine at a position corresponding to position 286 of human IgG2.
    [64] 64. A polypeptide comprising an immunoglobulin CH3 domain, wherein the CH3 domain contains a lysine at positions corresponding to positions 236 and 278 of human IgG2.
    [65] 65. The polypeptide of any one of claims 62-64, wherein the immunoglobulin CH3 domain is an IgG CH3 domain.
    [66] 66. A heteromultimeric polypeptide comprising both (i) the polypeptide of claim 62 or 63 and (ii) the polypeptide of claim 64.
    [67] 67. The heteromultimeric polypeptide of any one of claims 57-61 or 66, wherein the first and/or second CR3-domain containing polypeptide(s) further comprise an immunoglobulin CH2 domain.
    [68] 68. A polypeptide comprising the amino acid sequence of SEQ ID NO:1, SEQ ID NO:4, or SEQ ID NO:5.
    [69] 69. A polypeptide comprising the amino acid sequence of SEQ ID NO:2, SEQ ID NO:6, or SEQ ID NO:7.
    [70] 70. A polypeptide comprising the amino acid sequence of SEQ ID NO:3, SEQ ID NO:8, or SEQ ID NO:9.
    [71] 71. A heteromultimeric polypeptide comprising both a first amino acid sequence selected from the group consisting of SEQ ID NO:l, SEQ ID NO:2, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, and SEQ ID NO:7; and a second amino acid sequence selected from the group consisting of SEQ ID NO:3, SEQ ID NO:8, and SEQ ID NO:9.
    [72] 72. A heteromultimeric polypeptide comprising the polypeptide of any of claims 62-65 or 68 70. - 71
    [73] 73. The heteromultimeric polypeptide of any one of claims 57-61, 66, 67, 71, or 72 which is a heterodimer.
    [74] 74. The heteromultimeric polypeptide of any of claims 66, 67, 71, or 72 which is a bispecific antibody.
    [75] 75. The heteromultimeric polypeptide of any of claims 66, 67, 71, or 72 which is a monovalent antibody.
    [76] 76. The heteromultimeric polypeptide of any of claims 57-61, 66, 67, or 71-75, wherein the polypeptide specifically binds an antigen selected from the group consisting of: DLL4, VEGF, VEGFR2, Notchl, Notch2, Notch3, Notch4, Notch(pan), JAGI, JAG2, DLL(pan), JAG(pan), EGFR, ERBB2, ERBB3, ERBB(pan), c-Met, IGF-IR, PDGFR, Patched, Hedgehog family polypeptides, Hedgehog(pan), WNT family polypeptides, WNT(pan), FZD1, FZD2, FZD3, FZD4, FZD5, FZD6, FZD7, FZD8, FZD9, FZD1O, FZD(pan), LRP5, LRP6, CD20, IL-6, TNFalpha, IL-23, IL-17, CD80, CD86, CD3, CEA, Mucl6, PSMA, PSCA, CD44, c-Kit, DDR1, DDR2, RSPO1, RSPO2, RSPO3, RSPO4, RSPO(pan), BMP family polypeptides, BMP(pan), BMPR1 a, BMPR1b, and a combination thereof.
    [77] 77. The heteromultimeric polypeptide of claim 76, wherein heteromultimeric polypeptide comprises the VEGF binding sequence comprising heavy chain sequence of SEQ ID NO: 11 and the light chain sequence of SEQ ID NO:13 or SEQ ID NO:15.
    [78] 78. The heteromultimeric polypeptide of claim 76, wherein heteromultimeric polypeptide comprises the VEGF binding sequence comprising heavy chain sequence of SEQ ID NO: 11 and the light chain sequence of SEQ ID NO:13.
    [79] 79. The heteromultimeric polypeptide of claim 76, wherein heteromultimeric polypeptide comprises the VEGF binding sequence comprising heavy chain sequence of SEQ ID NO: 11 and the light chain sequence of SEQ ID NO:15.
    [80] 80. The heteromultimeric polypeptide of claim 76, wherein the heteromultimeric polypeptide comprises the DLL4 binding sequence comprising SEQ ID NO:19. - 72
    [81] 81. The heteromultimeric polypeptide of claim 76, which is a bispecific antibody that binds DLL4 and VEGF.
    [82] 82. The heteromultimeric polypeptide of any of claims 77-81, wherein the light chain polypeptides are identical in amino acid sequence.
    [83] 83. The heteromultimeric polypeptide of any of claims 77-82, wherein the light chain polypeptides are linked to the heavy chain polypeptides.
    [84] 84. The heteromultimeric polypeptide of any of claims 77-83, which comprises substituting amino acids in one CH3 domain at positions corresponding to position 249 and position 288 of human IgG2.
    [85] 85. The heteromultimeric polypeptide of claim 84, wherein the amino acids at positions 249 and 288 are replaced with glutamate.
    [86] 86. The heteromultimeric polypeptide of claim 84, wherein the amino acids at positions 249 and 288 are replaced with aspartate.
    [87] 87. The heteromultimeric polypeptide of any of claims 77-84, which further comprises substituting amino acids in the second CH3 domain at positions corresponding to position 236 and position 278 of human IgG2.
    [88] 88. The heteromultimeric polypeptide of claim 87, wherein the amino acid at position 236 is replaced with a lysine, and the amino acid at position 278 is replaced with a lysine.
    [89] 89. The heteromultimeric polypeptide of any of claims 77-88, which comprises substituting amino acids in one CH3 domain at positions corresponding to position 236 and position 278 of human IgG2.
    [90] 90. The heteromultimeric polypeptide of claim 89, wherein the amino acid at position 236 is replaced with a lysine, and the amino acid at position 278 is replaced with a lysine.
    [91] 91. The heteromultimeric polypeptide of any of claims 81-83, wherein the heteromultimeric polypeptide comprises a sequence selected from the group consisting of: SEQ ID NOs: 17-19. - 73
    [92] 92. The heteromultimeric polypeptide of any of claims 81-83, wherein the heteromultimeric polypeptide comprises the VEGF binding sequence comprising heavy chain sequence of SEQ ID NO:l l and the light chain sequence of SEQ ID NO:13 or SEQ ID NO:15; and the DLL4 binding sequence comprising SEQ ID NO: 19.
    [93] 93. The heteromultimeric polypeptide of any of claims 81-83, wherein the heteromultimeric polypeptide comprises the VEGF binding sequence comprising heavy chain sequence of SEQ ID NO:11 and the light chain sequence of SEQ ID NO:13; and the DLL4 binding sequence comprising SEQ ID NO:19.
    [94] 94. The heteromultimeric polypeptide of any of claims 81-83, wherein the heteromultimeric polypeptide comprises the VEGF binding sequence comprising heavy chain sequence of SEQ ID NO:1 1 and the light chain sequence of SEQ ID NO:15; and the DLL4 binding sequence comprising SEQ ID NO:19.
    [95] 95. The heteromultimeric polypeptide of any one of claims 57-61, 66, 67, or 71-94, wherein the first and/or second CH3-domain containing polypeptide(s) further comprise a single chain Fv.
    [96] 96. The heteromultimeric polypeptide of any of claims 57-61, 66, 67, or 71-95, wherein the polypeptide further comprises a cytotoxin or a radioisotope.
    [97] 97. An isolated polynucleotide encoding the antibody or polypeptide of any one of claims 49 96.
    [98] 98. An isolated polynucleotide that comprises a polynucleotide that hybridizes under conditions of high stringency to the polynucleotide of claim 98.
    [99] 99. A host cell comprising the nucleic acid of claim 97 or 98.
    [100] 100. A method of making a heteromultimeric polypeptide comprising culturing the host cell of claim 99 under conditions that result in expression of the polypeptide.
    [101] 101. A pharmaceutical composition comprising the heteromultimeric polypeptide of any of claims 50-54, 59, 60, or 64-81 and a pharmaceutically acceptable carrier. -74
    [102] 102. A method of treating a disorder comprising administering the heteromultimeric polypeptide of any of claims 57-61, 66, 67, or 71-95, or the composition of claim 101 to a q patient in need thereof.
    [103] 103. The method of claim 102, wherein the disorder is cancer.
    [104] 104. The method of claim 102 or 103, further comprising administering a second therapeutic compound.
    [105] 105. The method of claim 104, wherein the second therapeutic compound is used to treat a side effect caused by administration of the heteromultimeric polypeptide in the patient.
    [106] 106. The method of claim 104 or 105, wherein the second therapeutic compound is an anti cancer agent.
    [107] 107. The method of any of claims 104-106, wherein the heteromultimeric polypeptide and the second therapeutic compound are administered simultaneously or sequentially.
    [108] 108. An isolated polypeptide comprising an amino acid sequence selected from the group consisting of: SEQ ID NOs:10, 29 and 30.
    [109] 109. The isolated polypeptide sequence of claim 108 which is an antibody.
    [110] 110. An isolated polynucleotide that comprises a polynucleotide that hybridizes under conditions of high stringency to a polynucleotide selected from the group consisting of SEQ ID NOs: 12, 14, and 16. OncoMed Pharmaceuticals, Inc. Patent Attorneys for the Applicant/Nominated Person SPRUSON & FERGUSON
    类似技术:
    公开号 | 公开日 | 专利标题
    US20180312581A1|2018-11-01|Method For Making Heteromultimeric Molecules
    KR101834797B1|2018-03-07|Humanization of rabbit antibodies using a universal antibody framework
    TWI487712B|2015-06-11|Multispecific antibodies
    CA2638785C|2017-02-21|Anti-ephb4 antibodies and methods using same
    IL239604A|2016-08-31|Anti-vegf monoclonal antibodies, binding fragments and uses thereof
    AU2015308894A1|2017-03-23|Internalizing moieties for treatment of cancer
    EP2925778B1|2017-11-01|Anti-vegf antibodies and their uses
    JP2021524250A|2021-09-13|PSMA binder and its use
    CA2638133A1|2007-11-08|Anti-ephrinb2 antibodies and methods using same
    AU2013203859B2|2016-09-08|Method for making heteromultimeric molecules
    ES2528929T3|2015-02-13|Isoform-specific anti-HER4 antibodies
    KR20190114985A|2019-10-10|ERBB2 Antibodies and Uses thereof
    US20210246223A1|2021-08-12|ANTI-HER3 Antibody and uses thereof
    JP2020508694A5|2021-02-12|
    TW200813088A|2008-03-16|Antibodies to EGFL7 and methods for their use
    同族专利:
    公开号 | 公开日
    AU2013203859B2|2016-09-08|
    引用文献:
    公开号 | 申请日 | 公开日 | 申请人 | 专利标题
    SI2235064T1|2008-01-07|2016-04-29|Amgen Inc.|Method for making antibody fc-heterodimeric molecules using electrostatic steering effects|
    法律状态:
    2017-01-12| FGA| Letters patent sealed or granted (standard patent)|
    优先权:
    申请号 | 申请日 | 专利标题
    US61/173,129||2009-04-27||
    US61/177,412||2009-05-12||
    AU2010245011A|AU2010245011B2|2009-04-27|2010-04-27|Method for making heteromultimeric molecules|
    AU2013203859A|AU2013203859B2|2009-04-27|2013-04-11|Method for making heteromultimeric molecules|AU2013203859A| AU2013203859B2|2009-04-27|2013-04-11|Method for making heteromultimeric molecules|
    [返回顶部]